Cherry SNP DataBase

Gene information

Gene Pav_sc0001392.1_g300.1.mk
Chromosome name PAV_r1.0chr6
start 2488743
end 2492863
PAV_r1.0 name Pav_sc0001392.1
start 143367
end 147487
direction +
Annotation NR PREDICTED: WPP domain-interacting protein 2
Sequence CDS ATGGATTTGGAAATTGAATCTGTGGAAGATAATGAAGTAAACCCACAAACAGTGTTCCAT GCTGATGATAAGGATAATGATGATGGTAGTAATGAGATCAGGAACAATGGGTCATGTGCT AATGTGACTGAAAATGTAGCAAATACTAGAGTTAATCATGTTGACACTGCACAGCCAGTG AATTCGACTTTGCCGGCTGCCAACTCTCCCGGTGGGGGTTCACCTCCCACCGTCAAAGGG CTTGGCTTAAAGAAGTGGAGGAGGATTAAGAGAAATTTTTCTAGGGATGATAGTGACAAT GCATTTGATGATTCTAGTAAAGTTTTGAAGCGGGGTTTGTCTGGTAATGGAAACCCAGTT AAGTCTAAGAATTCACCCCGTGAAATCAATCATAACAGTGAAGGTTCTGTCGGATCTGTG AATACGTTAAGAAATGTGGGAGTTGTTGATGGCTTTGCAATTCATGGTTCAAGTTCTGAT TCCAGATTTGCTGTGGGTTCTGCATTTGCTGCTGGTGCAGATTCTGAGAACAGTGAGGAT CGGAGTAGCAAGTCTTCTACAGCTGCCAGTGTTCCAAAGGCCAAGTATGAGCTGCCTGCA GTATTGGGGCATGCAAGGGAGAAGAACAGGATGAAGAGTACCGGTGGAAAGAGTTTTTAT AGTTCAGCTCAAAGGGCCCAACAGGGAAGGGTACAAATTGAAAGCAGTAAGAAGCATAGA GGAGACGGGGTCAAGGTTGAGAAGGAAAACTCTTATTCCAGCGTGGAATCTGACTCAAGA AGCTCCAACCATGTGTTTATTCAGAGTCCAATTCTGACTAGTAACGGGAAGCAAAGTGGA AGGTCAATGAGTCATGACGGAGAAAACAGTGATGAAGTTCATGCAAGTGAACAACAATAC AGTGAAGAAGTTCAAACTGGTTATAGCAAAGAGAATGTAGGAGAAGCTGAAGTTTTTTCT CAAGATGACTTTCTTGCAGACTTGCCATGGAAGGTTAAGGGTGAAAAAAATAAGAATCGT AGGTCCTTAAAAGATCAGGATCCTCTGTTTGAGTCTATCCTTAATCTCCAGTCTGTACAA GAAGCACTTGCTAAAGAGGTTCAGAAATTCGGGGAGATTGGGAAGGAACCTTTATCACCG GGTGATAATTCAGTGAATGGTAGTGGTATACCTGCTGACCTCTCTTCAAGTGATCCGGGA ATCAATGAATCAAATTTATCTGACCATTTGGGTTCTGAAAAGATTGGACAAACTTCTTCG AAGTCCTTGGAAGCGCAAGTCTTAGGTTTGAAACAAAGTGTGAAGCTTTTGGAAAGCAAG TTGGATGAGAGTAGGGCTATGCTTGAGGTGAAGGAGTCCAGGGTTGCTGAACTCGAAGAT ATGATTAACATTAGCAAGTCTCCAAAAGAAGAATCAGGTAGTACCATAGATTTAGAGGAG GAAAAATATCGAGAGTTGGAGACTGAACTTGAGGGCCTGTTTAGGCAAATGATTGAAGCT CAGGTTGAGTATATTGCAATTAAAAGAACCACACAGAGGTTGAAGTTTGCTGCAGGTGGC CAAATTGCACTACTTGACGAGCAAGAAGAAGTGGCTGGAGAGCAAGCACAGATGCTGAAC AAGCTTGGAGAAGCAGAAATTAGGGCTGCAAAGCTAAAGGAACGAGCAGAGGAGTTGGGG AAATATGGTGGAGATATTGTAGCGACTGAAGAGGTTTTCACTATGCAGAAGAGGTTTTGT AAGATTACTTCATGTCTTTTTATTCAGATGATATTGCTGGGCTTAGCCGTCTGGTTTTTT TCCTTGCAGACCCCCCATCAAGGGGTGGCTGTACCCACCTGA
PEP MDLEIESVEDNEVNPQTVFHADDKDNDDGSNEIRNNGSCANVTENVANTRVNHVDTAQPV NSTLPAANSPGGGSPPTVKGLGLKKWRRIKRNFSRDDSDNAFDDSSKVLKRGLSGNGNPV KSKNSPREINHNSEGSVGSVNTLRNVGVVDGFAIHGSSSDSRFAVGSAFAAGADSENSED RSSKSSTAASVPKAKYELPAVLGHAREKNRMKSTGGKSFYSSAQRAQQGRVQIESSKKHR GDGVKVEKENSYSSVESDSRSSNHVFIQSPILTSNGKQSGRSMSHDGENSDEVHASEQQY SEEVQTGYSKENVGEAEVFSQDDFLADLPWKVKGEKNKNRRSLKDQDPLFESILNLQSVQ EALAKEVQKFGEIGKEPLSPGDNSVNGSGIPADLSSSDPGINESNLSDHLGSEKIGQTSS KSLEAQVLGLKQSVKLLESKLDESRAMLEVKESRVAELEDMINISKSPKEESGSTIDLEE EKYRELETELEGLFRQMIEAQVEYIAIKRTTQRLKFAAGGQIALLDEQEEVAGEQAQMLN KLGEAEIRAAKLKERAEELGKYGGDIVATEEVFTMQKRFCKITSCLFIQMILLGLAVWFF SLQTPHQGVAVPT


| Top |