Cherry SNP DataBase

Gene information

Gene Pav_sc0001405.1_g050.1.mk
Chromosome name PAV_r1.0chr2
start 22929132
end 22942236
PAV_r1.0 name Pav_sc0001405.1
start 35795
end 48899
direction +
Annotation NR hypothetical protein PRUPE_ppa005730mg
Sequence CDS ATGGGATGCTACAGAAGAGCAAAGCTTGCAGTAGATGCCTTTCGCGGATTCACTGCGAGG ATTGTACCCAAAGGTGTAGCTAAAGAACCCATTTCGAGAGCCTTCTCAACCGAGTCTTCC ACTTTGGCCTCCAACAAAGATAAGTTTTCTGGGTTTTCTCGGTATTCTTCTCTTTCACAA AAATCAATTCCACAACTTGGATTTACCAGAAGAACACAGTACACTAGTCCCTTTCTTGAT TCTGCCAAGAGATATTACTATGTCGATCGGAACAGCGTGCACCATTTTAAACCGAGAGGC CCCCGTAAGTGGTTTCAGAGTCCTAGAAACATGTTCATTGTGGTTCTGGTGGGTTCTGGG GTTTTCATCACTGTGTATTTTGGGAATTTGGAGACTATTCCCTACACGAAGCGAACCCAT TTTGTGATTTTGTCGAAAGCCTTGGAGAAGAAGATGGGAGAGTCCCAGTTTGAGCAATTG AAAGCCAGTTTCAAAGGGAAAATATTGCCTGCTATACACCCAGACAGCGTCCGCGTTAGG TTGATTGCCAAGGATATAATTGAGGCTTTGCAGAGAGGGTTAAGGCATGAGGTGGGCTGG AGTGACTTGGAGTATGCCTCTGATAGATTCGAGCCGGCACATGAAGGTAGTGGGCATGAC ACTTTGATGGCACTGAAGGACGTTGGAGAAGAGGTGAAGAAGTGGTCCCGTGAAGATGAG ATTCTTGATGATGAATGGATTCAGAAGAGTAGGAAGACGGGTCAGGAACGAGGTACTAAA ACTGCTACTTCGCATTTGGATCATCTGAATTGGGAGGTTTTGGTGGTGGATGAACCTGTT GTCAATGCATTTTGCTTGCCTGGCGGGAAGATTGTCGTCTTCACGGGGTTGCTGAAACAT TTTAGAAGTGATGCTGAGATAGCTACGATCATTGGTCATGAGGTTGGGCATGCGGTTGCT CGACATTCTGCAGAGGGCATTACAAAGAACCTGTGGTTTGCAATCCTGCAACTGATACTT TATCAGTTTGTTATGCCTGATGTTGTCAACACAATGTCCAATCTTTTCTTAAAGCTTCCT TTTTCTCGAAGGATGGAAATTGAAGCAGATCACATTGGGCTGCTGTTGGTTGCTTCTGCT GGATATGATCCTAGAGTGGCTCCAACGGTGTACGAGAAGTTGGGCAAAATTTCCGGTGAA TCTGCACTGAGAGATTATCTTTCAACCCATCCATCCGGTAAAAAGAGAGCTCAGTTGCTT GCTCAAGCTAAGATAATGGAAGAAGCACTTGCCATATACCGGGATGTAAGAGCTGGACGT GGGGTTGAAGAAACATATCAATATGCCAAAGATTTCAAACATGATAAGCTCCATAACCTG ACCGGCTGCAGGGTTTGCACCACTACAGCATTTTGTCAGAACTTTTGGGCAACGGGATCT TCACGGCGGATGGCGAAAAATGGCTACATCATAGAAAGGTATCAAGCATGTGAAATATCA TCCAAAGTAGTGAGAGACTTGGGCCGGGCGGTTTTCAAAACCAATGGTGTTAACTTGCTG GGATTATTTCTGAAGCTGCAACCTCCGGTCAAGCAACAGAGATCCAAATATTTTAATCTT GATGATTTGTTTACGAAAGCAGCCTCAGATTCAATCGTCAAGGTTCTCCTTGGTATCGAA CTAGACACCATGTATGGGACAAATGAAGAAGCTACCCAGTTTTCCAATGCTTTTGATGTA GCAAATGAAATGGCCATATATCGTTATGCTGATTTCTCCTGGAAGATCAAAAAGTTCTTA AACATTGGATCAGAAACTGCGCTAAGGAAAAATATCAAAGTGGTAGATGAATTTGTTTAT AACTTGATCAAAAGCAAGATTGAAACAGTTCCTAATTCAGGAGATGAGCTACATTCACTG AAGCTGCGGCAGAGTAAAATGGTGAGAGTGAACTTGTTCACGTTTCAGATAAACGGCTTC GATGGGCATGACCGAGTTTGTATTGTCGTGCCTGAACATCTGAACTGTTGGGCATGCGGT TGCTCGACATTCTGCAGAGGGCATTACAAAGAACCTGTGGTTTGCAATCATGCAACTGAT ACGTTATCAGTTTGTTATGCCTGA
PEP MGCYRRAKLAVDAFRGFTARIVPKGVAKEPISRAFSTESSTLASNKDKFSGFSRYSSLSQ KSIPQLGFTRRTQYTSPFLDSAKRYYYVDRNSVHHFKPRGPRKWFQSPRNMFIVVLVGSG VFITVYFGNLETIPYTKRTHFVILSKALEKKMGESQFEQLKASFKGKILPAIHPDSVRVR LIAKDIIEALQRGLRHEVGWSDLEYASDRFEPAHEGSGHDTLMALKDVGEEVKKWSREDE ILDDEWIQKSRKTGQERGTKTATSHLDHLNWEVLVVDEPVVNAFCLPGGKIVVFTGLLKH FRSDAEIATIIGHEVGHAVARHSAEGITKNLWFAILQLILYQFVMPDVVNTMSNLFLKLP FSRRMEIEADHIGLLLVASAGYDPRVAPTVYEKLGKISGESALRDYLSTHPSGKKRAQLL AQAKIMEEALAIYRDVRAGRGVEETYQYAKDFKHDKLHNLTGCRVCTTTAFCQNFWATGS SRRMAKNGYIIERYQACEISSKVVRDLGRAVFKTNGVNLLGLFLKLQPPVKQQRSKYFNL DDLFTKAASDSIVKVLLGIELDTMYGTNEEATQFSNAFDVANEMAIYRYADFSWKIKKFL NIGSETALRKNIKVVDEFVYNLIKSKIETVPNSGDELHSLKLRQSKMVRVNLFTFQINGF DGHDRVCIVVPEHLNCWACGCSTFCRGHYKEPVVCNHATDTLSVCYA


| Top |