Cherry SNP DataBase

Gene information

Gene Pav_sc0001405.1_g1250.1.mk
Chromosome name PAV_r1.0chr2
start 23521913
end 23525192
PAV_r1.0 name Pav_sc0001405.1
start 628576
end 631855
direction +
Annotation NR PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like
Sequence CDS ATGTGGTTGTTTAGAAGAAAAGGGCCATCTGGGTTCTCATCTTCTTCCACGGCAGAAGAA GTTACTCAAGGGATTGATGCCAGTGGTCTCACTGCCATTGTTACAGGAGCATCCAGTGGT ATTGGCACCGAAACTACACGCGTTCTTGCACTGCGTGGTGCCCATGTGATTATGGGAGTG AGGAATATGGCTGCTGGTAAAGATGTGAAAGAAGCAATAGTTAAGGAAATACCCACTGCC AAAATTGATGCTATTGAATTGGATCTCAGTTCATTATCATCTGTGAGGAAATTTGCCTCA GAGTTTAATTCCTCTGGTCGTCCTCTAAACATTCTAATTAACAATGCAGGAATTATGGCC ACCCCTTTCATGCTTTCGAAAGACAACATAGAACTTCAGTTTGCCACAAACCACGTGGGT CATTTTCTTTTGACAAATCTTTTATTGGATACTATGAAAAAAACAGCACGTAAAAGCAGC AAAGAAGGGAGAATTGTAAATGTGTCCTCAGAAGCTCACCGGTATCCATATCGGGAAGGA ATTCGTTTTGATAAAATTAACGACCCATCAGGGTACAGCAGTTTTGCTGCATATGGTCAA TCCAAGCTTGCTAACATTTTGCACGCTAATGAGCTTGCAAAACGTTTAAAGGAAGATGGA GCAGATATAACTGCAAACTCACTTCACCCTGGTGCAATTGTTACGAATCTTTTCCGTCAC AACAGCACCATTAATGGGCTTGTTAATTTGCTCGGTAGAGCTGTGCTTAAAAGTGTTCAG CAGGGAGCAGCAACAACATGCTACGTGGCACTGCATCCACAAGTGAAGGGGGTAACAGGT GAATATTTTTCAGACAGTAACCTAGCCAAGCCAAGGCCACAAGGTCAAGACGTGGACTTG GCGAAGAAACTCTGGGATTTCAGCATGGATTTGGTGAAATGA
PEP MWLFRRKGPSGFSSSSTAEEVTQGIDASGLTAIVTGASSGIGTETTRVLALRGAHVIMGV RNMAAGKDVKEAIVKEIPTAKIDAIELDLSSLSSVRKFASEFNSSGRPLNILINNAGIMA TPFMLSKDNIELQFATNHVGHFLLTNLLLDTMKKTARKSSKEGRIVNVSSEAHRYPYREG IRFDKINDPSGYSSFAAYGQSKLANILHANELAKRLKEDGADITANSLHPGAIVTNLFRH NSTINGLVNLLGRAVLKSVQQGAATTCYVALHPQVKGVTGEYFSDSNLAKPRPQGQDVDL AKKLWDFSMDLVK


| Top |