Cherry SNP DataBase

Gene information

Gene Pav_sc0001405.1_g870.1.mk
Chromosome name PAV_r1.0chr2
start 23308898
end 23319919
PAV_r1.0 name Pav_sc0001405.1
start 415561
end 426582
direction -
Annotation NR PREDICTED: DNA mismatch repair protein MSH3
Sequence CDS ATGAACATGCCAAATTTGGCAGTCCAAGCACTGGCCTTAACTGTTCGTCATCTGAAACAA TTTGGTTTAGAAAGGATCCTGCACCTAGGAGCTTCTTTTAGGCCCCTCTCAAGCAGCACG GAGATGACTCTCTCGGCCAATGCACTTCAGCAATTGGAGGTATTGAAGAACAATGCTGAT GGGTCTGAGTCTGGCTCTTTGCTGCAGTCTATGAATCAAACTCTTACCATATTTGGTTCA AGGCTTCTTAGACATTGGGTAACTCACCCTTTATGTGATAGAAACATGATTTGTGCTCGT CTTGATGCTGTTTCTGAGATTGCAGAGTCAATGGGGTCTTCTAAAGCTCCTCAGAATGTT GAACAGCATGATGCGGAAGATTCTTTTGTAACAAATTTGAAACCAAAGTTAAATTATATA CTTTCTTCAGTTCTGACGACTTTGGGACGGTCAACTGATATTCAACGTGGGATAACAAGA ATCTTTCATCGGACTGCCACTCCATCTGAGTTCATTGCAGTGATTCAAGCTATTTTATAT GCTGGAAAACAACTTCAGCAACTTCAAATTGAAGAAGAGGGAAGCAAAGAAAATTTGAGA GGAAAGACAGGACGCTCTGACCTGCTGAGGAAGTTGATATGTACTGCTTCGTCATCCACT GTAATTGGAAATGCTGCAAGACTGTTGTCTACCCTTAACAAAGAAGCAGCCGACAAACAG GATCTACCAAATTTAATAATCTCTGATGGCCAATTTCCTGAGGTTGCTGAAGCACGGATG GAGGTTCAATTGGCAAAGGAAAAATTGGATTCTCTCATCAGTTTGTATCGCAAACAGCTT GGAATGCGCAAGTTGGAATTCATTAGTGTGTCTGGAACAACACACTTGATAGAGTTGCCC TTAGATGTAAAGGTGCCTTCAAATTGGGTTAAGATCAATAGTACCAAAAAGACTGTCCGG TATCACCCACCTGATGTTTTGACAGCTTTAGACCATCTAGCCCTTGCAAATGAGAAACTC ACTATCACCTGTCGTGCTGCTTGGGATAACTTTCTAAGCGGTTTTGGTAAATATTATGCT GAGTTCCAAGCTGCTGTTCAAGCACTAGCGAGTTTAGATTGTCTTCATTCACTTGCTGTT CTTTCAAGAAATAAGAACTATGTTCGTCCAGTGATCGTATATGATGATGAACCTGTCCAG ATACATATATTGTCTGGCCGTCATCCGGTCATAGAGACTACATTACAAGACAATTTTGTT CCAAATGACACAGATTTGCAGGCAGACAGAGAGTATTGTCAGATTATTACTGGACCTAAC ATGGGTGGAAAGAGTTGCTACATTCACCAAGTTGCTCTCATTGCTATCATGGCTCAGGTT GGTTCCTTTGTACCAGCATCATCGGCAAAGCTGCATGTGCTGGATGGAATTTTCACTCGA ATGGGTGCTTCTGACAGTATCCACCAAGGGAGAAGCACTTTTCTTGAAGAACTGAGCGAG GCTTCACATATACTCCACAATTGCACAGCACGCTCATTGGTTATCATCGATGAGCTTGGG AGAGGCACGAGTACACATGATGGCGTGGCTATTGCTTACGCTACATTACATAATCTGCTA CAGCAGAAAAAATGCATGGTCCTCTTTGTGACGCACTATCCAAAAATTGCTTATATTAGA ACTGAATTCCCAGGCTCAGTGGAGGCATACCATGTTTCTTATCTGACTTCAAATAGAGAT ATGGATACGGTAGGCATGCAATCTGAAAATGAAGATGTCACTTACTTATATAAGCTTGTG CCTGGTGTTTCAGAGAGGAGCTTTGGATTTAAGGTTGCGGAGCTTGCACAGCTACCTTCC TCGTGCATAAGACAAGCGACTATCATGGCTGCTAGGTTGGAGGCAGTAGTAAACAGCCGA GCAAGAAACAGACATGGAAAAAATTGGTTGCTAAAATCACTGGTAACAGATCAAAAGAAA GAAGCACAAGATGAAATGCTGGAATCTCCCGAGTGCCTTCATGTAGGATGGAGTCCGGTT TTAGAGGAGACAAATGGTGGTGCGTATCAGAAATTCTTTATGAATTTGAAAGCTGCAATA ATTGATGTTGACGACCCTGTACAAAGCTTTCAGTATTTGAATCACGCAAGAAGCATTGCA AGAGAGTTAATAAGCAGAGAAACAATGGAATGGGAAGATGGGAAGACTTTGGGGAGATGG GAAGACCTCAGCACCGACATATTGTGGAAGATTTTTGAGTCCTTCAACGACGTCTCTGAT TTATCTTCCGCCGTTGAAAAGGTCCATTGCAGTGCCGTTTGCAGTGCATGGCGTTCGGCT CTCTGCGATCCCAACCTTTGGCATACACTTGATTTGTCAATGATTAAACATAATTTCATC AAAACCAAAGATAAGCCGTATGTTTATGTTTGCAGCCACTCCGATTTGACATTGAGTCGT GTTTTGAAGGTTTCTCTGAGTCTCAGCCACCAAAACATAACCACCTTGATTTTCAATCTC CAGTTATATGTCCCCGACGACCTCTTCACTTACACCGCTGAAAGGTGCCCGAAGCTGAGA CGATTAGTTATGCCATCTTGGAACAAAATAAAGATTGATGGCATCAGCAAGGCCATTGGG TGTTGGAAACATCTTGAATCGCTGACAATAGGGAACATAGAAAAGTATCAATACCTCACT CTCTTGCAGGTGATTGACTACAACTGCAAGAACTTCAGGGAACTCAAATTGATGGGTACT TGTGATACATATTCCTTTGCCTCAGCAATGGTTAGATATCTTCCAAAACTGGAGGTTTTA AGCCTCCGGTGCTCGATGTTGTCGAAGGACGCTTTGATGGTGATATTGGAGGGCCTACCC AACTTGGAAGTTCTCAACATATCGCATTGCGTTGTATTGGATGAAACCCATCAGCCTCAT CAACCTTTTAGAATTGTTGAGGAGCTTGATGCATCCATTGTTGACAAGGCTTCAAGGTTA AAGAGATTTATAACGTGCATGCGTATGCCTACGGCCATGCATGTGCAGGAAGACTCGTGC AGCATGTGTCAAAGGACCAGAAACGACGAGGGGATCATCAGGTGGCATAGATATGAAGAA GGAATGTGGAAAGCAGATGAAGTGGCCTCCCTTGCTCTTTGA
PEP MNMPNLAVQALALTVRHLKQFGLERILHLGASFRPLSSSTEMTLSANALQQLEVLKNNAD GSESGSLLQSMNQTLTIFGSRLLRHWVTHPLCDRNMICARLDAVSEIAESMGSSKAPQNV EQHDAEDSFVTNLKPKLNYILSSVLTTLGRSTDIQRGITRIFHRTATPSEFIAVIQAILY AGKQLQQLQIEEEGSKENLRGKTGRSDLLRKLICTASSSTVIGNAARLLSTLNKEAADKQ DLPNLIISDGQFPEVAEARMEVQLAKEKLDSLISLYRKQLGMRKLEFISVSGTTHLIELP LDVKVPSNWVKINSTKKTVRYHPPDVLTALDHLALANEKLTITCRAAWDNFLSGFGKYYA EFQAAVQALASLDCLHSLAVLSRNKNYVRPVIVYDDEPVQIHILSGRHPVIETTLQDNFV PNDTDLQADREYCQIITGPNMGGKSCYIHQVALIAIMAQVGSFVPASSAKLHVLDGIFTR MGASDSIHQGRSTFLEELSEASHILHNCTARSLVIIDELGRGTSTHDGVAIAYATLHNLL QQKKCMVLFVTHYPKIAYIRTEFPGSVEAYHVSYLTSNRDMDTVGMQSENEDVTYLYKLV PGVSERSFGFKVAELAQLPSSCIRQATIMAARLEAVVNSRARNRHGKNWLLKSLVTDQKK EAQDEMLESPECLHVGWSPVLEETNGGAYQKFFMNLKAAIIDVDDPVQSFQYLNHARSIA RELISRETMEWEDGKTLGRWEDLSTDILWKIFESFNDVSDLSSAVEKVHCSAVCSAWRSA LCDPNLWHTLDLSMIKHNFIKTKDKPYVYVCSHSDLTLSRVLKVSLSLSHQNITTLIFNL QLYVPDDLFTYTAERCPKLRRLVMPSWNKIKIDGISKAIGCWKHLESLTIGNIEKYQYLT LLQVIDYNCKNFRELKLMGTCDTYSFASAMVRYLPKLEVLSLRCSMLSKDALMVILEGLP NLEVLNISHCVVLDETHQPHQPFRIVEELDASIVDKASRLKRFITCMRMPTAMHVQEDSC SMCQRTRNDEGIIRWHRYEEGMWKADEVASLAL


| Top |