Cherry SNP DataBase

Gene information

Gene Pav_sc0001405.1_g950.1.mk
Chromosome name PAV_r1.0chr2
start 23352582
end 23356952
PAV_r1.0 name Pav_sc0001405.1
start 459245
end 463615
direction +
Annotation NR PREDICTED: interaptin
Sequence CDS ATGTTCAAGTCATGGAGCAAGAAGAAGAAGATAAAAGCTATATTCCAACTGCAGTTTCAG GCAACGCAGGTGCCGAAATTGAAAAAGCCTGCTTTGATGTTGTCTTTGGTGCCGGACGAC GTCGGAAAGCCCACGGTGAAACTAGGAAAAGCTGCAGTTCAGGATGGAACCTGTATTTGG GAGAATCCAGTTTATGAATCAGTGAAACTCATTGAGGAATCAAAAACGGGAAAACTGAAA GAGAAGATTTATCACTTCATTGTTTCAACCGGCTCATCAAAAGCTGGTTATCTTGGAGAA GCTTCAATTGATTTTGCAGATATTGTGGCAGAAACTGAACCCCTAACAGTCATTCTGCCC CTTAAATTTGCAAACTCTGGTGTAGTTTTACATGTAACAATTCACAGGATTCAGGAAGAT GGTGATCAAAGGGAAATTGAAGAAGATGATGATCCGACTCTTTCACGCCATAGCAGCATG GACAACCAGAACAGCAATTGGGATACAGATGGAGGCAACCACCTCAGTTTTACGGAAAAT GGAGCCTGTGACAAAACCACTAATGGCCATCAGGATGCTGCCAGCTCCCTGTCACCCCTT GAACAAAACTCCATGCCTCAAAACGGAAACAACGGTGCCACCGCAAGAAAAAACCATATG CGTCAAAAATCAAGCTTGGATTGGTCATCAGATGGAAGTTTATTTGATTCACCAAATAGT GTTGAAGACAAGCTTCCAACCGAAAGGGTGCAAACGGGTTCAGATGATTCCATTGAAAAA CTCAGAAATGAAATTGCTATTCTTATGAGGCAGGCAGACCTATCAGAACTGGAGTTACAG TCTCTTCGGAAACAGATGGCCAAAGAGAGTAAACAAGGACAGAATCTCTCAAGACAAGTT ATTAGCCTTAAAGAGGAGAGAGATGCACTCAGAATAGAATGCGAACAACTGAAGTCCTCG CAGGGACGTAGCGATGGGGAACAGGCTTTCAAAAAGTTGCAGCCCGAGACCAAGGATACA AGAGATCAGTTAGAAGCAATGAAGCAAGAGCTTAATTTTGAAAAGAAAGTTAGAACCAAT CTTCACTTGCAACTGCAGAAGACACGAGATTCAAATTCTGAGTTGGTCCTAGTGTTGAAG GATCTTGAAGACGCGTTGGAGAAGAAAAAAAGGGAAGTATCTGATCTTTCAAGCAAGTTA GAAACTGAAAAGAATTCCAAAGTGATGGGTAAAATGTTTGAGGATGAAAACCAAAAATCT GCAGAGAAACTGACTAAGAAGCACAGTGATGTCCAGGAAGTAGAATCCTTGAAGCTTAAG ATCAGAGAACTTCTTAGTGAAATAGACACCCACGAGAAGAAGAGGGAAGAGCAAGATGCG CATATAAAACAGCTCACCTTGGACCATGACCTTTTAAAGCAGGACAACTATGGCATCTCT TTGAAGTTAGATCGTAACCAAGAAAGACTACGAACAGAGATGGAAAATGAGCGGGCAGGC TATATAGCTACTATAAAAGAGCTTGAATCTCAGTTGGAGAGATCAGAAGAAACAATTGAG AAGCAAGCACATGAATTTGCAGAATGTTTGATCTCCATTCAGGAACTTGAAAGTGAGGTT AAGTCTTTGGAGATAGAACTGGAGACACAGGCCAAGGGGTTTGAAGAGAAACTGGAGGCT GTGACATGTGCCAAGGTTGAGCAAGAACAGAGGGCCATCCAAGCAGAGGAAACATTGAAA AAGACAAGGTGGAATAATTCTGTTACAGCTGAGCGTCTTCAAGAGGAGTTTAGAAGGCTT TCTGTGGAAATGACATCTAAGGTTGATGAAAATGAGAAGCAGGCCACAAAAGCACTGGCA GAAGCTAATGAACTGCGTCAGCAGAACAGAATTCTGGAAGAGATGCTCCAGGAAGCCAAT GAAGAGTTAGAGCTGATTAAGGACCAGAATGAAGTAAGATTGCAAGATCTTGTCAACCAG ATTGATGTGAAAGCAAAACATATAGAGCAGATATCATTGGAACTAGACAATAAATCCCAG CTCCTTGAACATGCAAAAAAGCATGAGGAGGAAGAACATGAAGCTCTCTCAATGAAAATG CAAATGCTCAAAGCTGAGATAGAAAGGCTCACAGAAGAGAATTCTAACTCCACAAAACAG GAGGAAGAGAAATTGAGAGGAGATTTGAAACAAATGAACAAACTAATTGCTGAAAATGAG ATGCGGATCCAGTGTTTGAATGTTGAAAAGGATAATTTGGAGAAAAGATTTGCTTCCGCA AAGCAGGAAGCAGAGAAAACACATCATGAACTTACCAATATGAGATCTTTAAAAGAAGAG AAGGAAACGACAATCGCTTATCTGAAGTCAGAAGTGCAAAACCTGAGGACCCAGCACAAA GAGTTTAAGGATACCTTATCTAAGGAAGCATTGGCAAAAGAAAGCTTGAGGAAACAAATA TCTCAGTTACAGGGTCAAAGGAAAACAGAAGACTGCTCAGAGAAAAAGTTGAAAGCCGCC ACTTTCCATACCAGTGATGAGAATAATTTTACAGACTTGCTGACTGAATTGACATTACTG AAGGAAAGAAACAAATCTATGGAAAAAGAACTAAAGGATATGCAAGAAAGATATTCAGAG ATAAGTCTCAGATTTGCAGAGGTTGAAGGTGAACGGCAACAACTTGTAATGACTGTGCGT AACCTCAGAAGCAGTAAGAAGAACTAG
PEP MFKSWSKKKKIKAIFQLQFQATQVPKLKKPALMLSLVPDDVGKPTVKLGKAAVQDGTCIW ENPVYESVKLIEESKTGKLKEKIYHFIVSTGSSKAGYLGEASIDFADIVAETEPLTVILP LKFANSGVVLHVTIHRIQEDGDQREIEEDDDPTLSRHSSMDNQNSNWDTDGGNHLSFTEN GACDKTTNGHQDAASSLSPLEQNSMPQNGNNGATARKNHMRQKSSLDWSSDGSLFDSPNS VEDKLPTERVQTGSDDSIEKLRNEIAILMRQADLSELELQSLRKQMAKESKQGQNLSRQV ISLKEERDALRIECEQLKSSQGRSDGEQAFKKLQPETKDTRDQLEAMKQELNFEKKVRTN LHLQLQKTRDSNSELVLVLKDLEDALEKKKREVSDLSSKLETEKNSKVMGKMFEDENQKS AEKLTKKHSDVQEVESLKLKIRELLSEIDTHEKKREEQDAHIKQLTLDHDLLKQDNYGIS LKLDRNQERLRTEMENERAGYIATIKELESQLERSEETIEKQAHEFAECLISIQELESEV KSLEIELETQAKGFEEKLEAVTCAKVEQEQRAIQAEETLKKTRWNNSVTAERLQEEFRRL SVEMTSKVDENEKQATKALAEANELRQQNRILEEMLQEANEELELIKDQNEVRLQDLVNQ IDVKAKHIEQISLELDNKSQLLEHAKKHEEEEHEALSMKMQMLKAEIERLTEENSNSTKQ EEEKLRGDLKQMNKLIAENEMRIQCLNVEKDNLEKRFASAKQEAEKTHHELTNMRSLKEE KETTIAYLKSEVQNLRTQHKEFKDTLSKEALAKESLRKQISQLQGQRKTEDCSEKKLKAA TFHTSDENNFTDLLTELTLLKERNKSMEKELKDMQERYSEISLRFAEVEGERQQLVMTVR NLRSSKKN


| Top |