Cherry SNP DataBase

Gene information

Gene Pav_sc0001411.1_g340.1.mk
Chromosome name PAV_r1.0chr3
start 10937605
end 10949837
PAV_r1.0 name Pav_sc0001411.1
start 172849
end 185081
direction -
Annotation NR RING/U-box superfamily protein isoform 2
Sequence CDS ATGGGTTGCTTGAGTTTGGAAATGGGGGTCGTGAAAATTTTGGGGTTTATGTGGTCTCAG AGAAGGAAGTTGAGGTTTCTATACTGGGTTGCATTCTGGTTGTGTGTAGCTTTGGTGCTT TTTCAGCCGGTGGCGGGTCTCAGACCCTTGCGGGAAAGGGCTCGCTCGTGGGGTGATGAG TGGCTATTTGTAAGAAAAGATGAAAGTGATTTGGGTCCATTTTCTACATGGAACATAACA GGAACTTACAGAGGGACTTGGAAGTTTCCTGATTCTGCAAATAGCTCTTCCAGATTTCCG GATTTTAGGAAATCCGACGGCAACTCTATCATCGAATTAGTTAGCACGCAAACAAAAATA ACTGGTGTACATTACGTGCAGGGTGTAATTATTTTCCATGATGTGTTCGACAATGAACAC AATGTTGGTGGTGTTCAAATCAAGGTGGAAGGTGTATTTATATGGCCGTTTAGACAACTT CGAATGGTAGCTAACAGTGGAAAAGAGGGAGAGTCCAGTCAAGAAGAAGATTACATGTTG TCAAATCCGTATCATATGCTTGGAGTTTTCTCTTCCCAGGTTTTCCAAGAATCTCCTCGA GATAAGATATGGAGGAAAAAGCATTCTCCAATTTATGAAATGGAGAAACATTGTAATATA GAAATTGCGGGCCAAATTTCACGTGTCTCATCCCCCCATAATGATGGTGATCGTGATCGT TACCACATAGAAGCATTCATGGAGAGTCCTGCAGTGGATGATGATGGAGATTGCTTCTCA CCCTTGATACTAAATGCTACATCTGTCAACGTTGAGGTGTACTACAACAAAGCAGTGAAC TATACCTTGATGGTCACCTTTGTCTCCTTTCTCCAAGTTCTTCTCTTAATTCGCCAAATG GAACATAGCAACACTCAGTCGGGGGCTGCCAAAGTTTCAATTCTAATGATTGGCCAACAG GCTATCATGGATGCTTATCTTTGCCTTCTACATTTGACCGCAGGAATACTTGTTGAATCC TTATTTAATGCTTTTGCAACTGCCGCTTTTTTCAAGTTTGTTGTCTTCTCAATATTTGAG ATGAGATATCTTCTTGCTATATGGAAAGCAAGTAGGCCTACAAATAGTGGAGAAGGTTGG GAGACAATGAGGCATGGGATCCTTTTGGGAGGCATTCTGTTCATGTATGAGTTCCATAAC TTCCTGAGACCTATTCTTCTCCTTATGTACTCCTTTTGGATACCACAAATAATCACCAAT GTTATTCGTGATTCGAGGAAACCATTGCATCCTCATTACATCTTAGGCATGACTGTTACT CGGCTTGCAATCCCGTTATACATATTTGGTTGCCCTAACAACTTCATGCGTATTGAGCCC GACAAGAGTTGGTGTATTTGTTTGGGTGTATTTATTGGACTGCAAGCATCAATTCTTCTT CTTCAGCACTATCTTGGCTCTCGATGGTTCATTCCTCGTCAGATTCTACCTGAAAAATAT AGCTACTTTAGAAGGTATGATCAGGATACACATCACACCACAGACTGTGTCATTTGCATG ACTGCAGTTGATCTCGCACAGCGTGACACCGTGCGACCATTTCTTTCATTCAGGTTGTTT ACAAAGGTGGATGGATATAAAGATGGAGTGCCCAACTTGTCGGCGTCCACTGCCACCAGC CTGATCCGTTCACTCTGTCTATATCACGTATAG
PEP MGCLSLEMGVVKILGFMWSQRRKLRFLYWVAFWLCVALVLFQPVAGLRPLRERARSWGDE WLFVRKDESDLGPFSTWNITGTYRGTWKFPDSANSSSRFPDFRKSDGNSIIELVSTQTKI TGVHYVQGVIIFHDVFDNEHNVGGVQIKVEGVFIWPFRQLRMVANSGKEGESSQEEDYML SNPYHMLGVFSSQVFQESPRDKIWRKKHSPIYEMEKHCNIEIAGQISRVSSPHNDGDRDR YHIEAFMESPAVDDDGDCFSPLILNATSVNVEVYYNKAVNYTLMVTFVSFLQVLLLIRQM EHSNTQSGAAKVSILMIGQQAIMDAYLCLLHLTAGILVESLFNAFATAAFFKFVVFSIFE MRYLLAIWKASRPTNSGEGWETMRHGILLGGILFMYEFHNFLRPILLLMYSFWIPQIITN VIRDSRKPLHPHYILGMTVTRLAIPLYIFGCPNNFMRIEPDKSWCICLGVFIGLQASILL LQHYLGSRWFIPRQILPEKYSYFRRYDQDTHHTTDCVICMTAVDLAQRDTVRPFLSFRLF TKVDGYKDGVPNLSASTATSLIRSLCLYHV


| Top |