Cherry SNP DataBase

Gene information

Gene Pav_sc0001422.1_g050.1.mk
Chromosome name PAV_r1.0chr8
start 12170745
end 12176025
PAV_r1.0 name Pav_sc0001422.1
start 24353
end 29633
direction +
Annotation NR PREDICTED: uncharacterized protein At4g04775-like
Sequence CDS ATGGTTGATACATATCTCACATCAGCCCCTTCAGGAATGACATTTTACAGGAGCCATACC CCTGAAGATTCTGAGCTGAAATGCCTGTGTGGGCTTCCTGCAAAACTGAGATTATCTCAA ACCCCAAAAAACCCGTTTAGGTTATTCTATAATTGTCCAAAGGGTGTTTCTGCACAATGT GAATTCTTTCGTTGGTGGGATGAGCCAGCTCCAACGGGCAATAGGGAGACCGATGAGCAA AATCTTATCCGTCATGAGTGCATTCGACTACAAGAAAGCTTAAATGAAATCCAACAGGAA CTGGATTGTGAAAGGACTGAATGGGGTAGGGAAAAATCAGAGCTAACTTCACAACTATCA ACTGTGCAGTCTGAGCTTGATGCTCTCAAGAAAAGAATCAAGATGGCAAATGAATCAGAT CTTATGCCCCCTCTTGACAAGCCATCCATAGCAGATGATGAGGATGATGATGCCTTTGTA CTGCATACTGTATGCTGA
PEP MVDTYLTSAPSGMTFYRSHTPEDSELKCLCGLPAKLRLSQTPKNPFRLFYNCPKGVSAQC EFFRWWDEPAPTGNRETDEQNLIRHECIRLQESLNEIQQELDCERTEWGREKSELTSQLS TVQSELDALKKRIKMANESDLMPPLDKPSIADDEDDDAFVLHTVC


| Top |