Cherry SNP DataBase

Gene information

Gene Pav_sc0001431.1_g010.1.mk
Chromosome name PAV_r1.0chr4
start 8289507
end 8304884
PAV_r1.0 name Pav_sc0001431.1
start 6446
end 21823
direction -
Annotation NR PREDICTED: uncharacterized protein LOC103328705
Sequence CDS ATGCAGCAAGATGATTGTAAAACTTTCTTTTCTACTATTAACAGTTTAACTTCTTCGATA AGTCTGAGGCAGCAGAAGCTTAGAGAAAAAAAAGAGAGGGAGAAGGCCCTTAGGGCCAAG AAGGCGAAAGAGAAACTGGCGAAGGGGCTAGCCAACACGTCCGAGGAGGCGGAGGGGCGT GCTCTTGAGAAGCGGTGGAGGGATGGTGACGAAGGGCTGTCCGAGTTGGACAAAAGGCAT ATGGGATTAGAGACAGTTATCCATGACGTCATGGGTAGAATAGAGCTGCCACCCTGTGAT CTAGACCCTTCACCGAAGCTACCGCTAGGCCTAGATGAGCTGTTCCCCGAGGGCCCAGAG GACATAGACTTCACCGTGGTTCGGCGGCAGAAGTCAGTCTTGTTTGTTGCCAACGCCCTA GCCAGGGCACAGAGAGAGGTGGCGTTGGCCAGGCGCCATTCAGAGTCAGCGAAGGCTGCT ACTACCGAGGCTCAGGCTTACATTCGAGAGAAGAATGCCCTGCAGTTGAAGGTAGGGCGG TTGGAGAGGGAGCTGAAGAAGGTGTCTCGCCGACTAGAGGCTGCCGAGGAGGCCAGGGTG GAGGCTGAGAGAAAGAAGGCGGAGGAGCTGGCTGCGGCTTGTGCTCAGGCAGTAGAGAAG TACAAGGTTTCTGATGAGTAG
PEP MQQDDCKTFFSTINSLTSSISLRQQKLREKKEREKALRAKKAKEKLAKGLANTSEEAEGR ALEKRWRDGDEGLSELDKRHMGLETVIHDVMGRIELPPCDLDPSPKLPLGLDELFPEGPE DIDFTVVRRQKSVLFVANALARAQREVALARRHSESAKAATTEAQAYIREKNALQLKVGR LERELKKVSRRLEAAEEARVEAERKKAEELAAACAQAVEKYKVSDE


| Top |