Cherry SNP DataBase

Gene information

Gene Pav_sc0001448.1_g130.1.mk
Chromosome name PAV_r1.0chr6
start 16316612
end 16318445
PAV_r1.0 name Pav_sc0001448.1
start 75994
end 77827
direction -
Annotation NR PREDICTED: UDP-glycosyltransferase 86A1-like
Sequence CDS ATGGTCATGGTCATTTTACTTCACATGTTTGTGTGTGTAATATTAGATAATCCTCGCCAA GACACGATCAATTACATACCGGGTGTACGCGCGATTGAACCAAAGGACTTGTCATCGTAC CTTCAACCTAGTGATTACACTTCACCCATACACCGGATCATAGTCAATGCCTTTGAGAGA ATTAAAAAACAAGATTTCATTCTTTGTAACACAGTCCAAGAGCTTGAATCTGAGACCGTT TCAGCCTTGCAAGAAAAGCAACAAATATATTCAATTGGACCAATATTCCCCACCGGGTTC ACCAAGAGCCGTGTGGCCACAAGCCTGTGGTCCGAGTCAGATTGCATCCAATGGCTCAAC ACTAGGCCACGTGGCTCAGTTTTGTACGTTTCATTTGGTAGCTATGCTCATGCTAGCAAA AGAGAGATTGAGGAAATAGCCAATGGGCTTTTGCTCAGCAAAGTTGGTTTTATTTGGGTA CTTCGTCCTGATATAGTCAGCTCTGATGAACCCGAAATCCTACCCGTAGGATTTGAAGAT GAGATCAAAGATCAAGATCAAGGTTTGATTGTGCCATGGTGCTCTCAGATTGAGGTGATC TCACACCCTTCAATTGGAGGCTTCATAACACATTGTGGATGGAATTCAATACTGGAAAGC ATATGGTGCAATCTTCCCTTGTTGTGTTTTCCTTTGTTGACTGACCAATTCACTAATAGG AAATTAGTGGTGGATGATTGGAGGGTTGGGCTTAATCTTTTTGACCAAAAACCAATCACA AAGGAGGAAGTGGCAGAGAAGATCAGCCGTCTGATGAGTGCTGATGAATTGAGGAGGAAT GTCAAGGAGGTCAGAAAAGCATTGGAGGGTGCATTGGCTATTGGTGGGTCATCATACAGA AATCTTGATCAATTCATAGATGGTGTGAAGACTAAAGTCCAAGAGAAAACTGGGTTTGGC TTCAAGAACACTGAAGTTTCCTAG
PEP MVMVILLHMFVCVILDNPRQDTINYIPGVRAIEPKDLSSYLQPSDYTSPIHRIIVNAFER IKKQDFILCNTVQELESETVSALQEKQQIYSIGPIFPTGFTKSRVATSLWSESDCIQWLN TRPRGSVLYVSFGSYAHASKREIEEIANGLLLSKVGFIWVLRPDIVSSDEPEILPVGFED EIKDQDQGLIVPWCSQIEVISHPSIGGFITHCGWNSILESIWCNLPLLCFPLLTDQFTNR KLVVDDWRVGLNLFDQKPITKEEVAEKISRLMSADELRRNVKEVRKALEGALAIGGSSYR NLDQFIDGVKTKVQEKTGFGFKNTEVS


| Top |