Cherry SNP DataBase

Gene information

Gene Pav_sc0001461.1_g010.1.mk
Chromosome name PAV_r1.0chr5
start 491781
end 497221
PAV_r1.0 name Pav_sc0001461.1
start 946
end 6386
direction +
Annotation NR PREDICTED: MLO protein homolog 1-like
Sequence CDS ATGGCTCCAGCAGCTGCCGGAGAAAGGTCTTTAAAAGAAACACCCACATGGGCTGTTGCC ATTGCCTGTGCAGTTTTCATACTTATTTCTATAATTATAGAACAAGCAATTCATGCTCTT GGAAAGTGGTTCCAGAAACGCAATAAGAAAGCTATGCTTGAAGCTTTGGAGAAAATAAAA GCTGAGCTCATGCTTTTGGGATTCATATCTCTACTACTTACGGTGGGCACAAGATATCTT CCAAAAATATGCATCCCAGAAAAGTACGGAAATACGATGCTTCCATGCGAGCTAGAGAGC AAGTATAAAGATGATGGGGGCGGCAAGGATGATGGCAAAAACAAAGGAGGTGGAGAAGGA GATGGTGATGAAAATGACAGGCGACGAAAGTTACTGGAATTTGCTGAAACCATGATATGG CGTCGAGTTTTAGCCGCCCCTAGTGGAGGAGATTCTTCTGCTTGTTCAGAGATGAAGAAA TGGAAAGCTTGGGAATCAGAGACCTCGTCCTTGGAATATCAATTCACAAATGATCCTTCA AGGTTCAGGTTTACTCGACAAACTTCGTTTGTGAAGCGTCACTCAGGCTTTTCTACAATG CCTGGAATAAGATGGATTGTGGCATTTTTCAGGCAATTCATTGGTTCAGTTACGAAGGTG GACTATTTGACCATGCGCCACGGATTTATCAATGCACATTTTGCTCCAAATAGCAAATTT GACTTCCATAAGTATATTAAGAGATCCATGGAAGATGACTTCAAGATCGTCGTGGAATGG CACGCGTTCACTTGGTTGTCATTGGCGCCACTCATTGTAAGTGCTAGCTTCTTCTTCTTC TTCAAGTCCTCTATCATTAATACTTTTGTATTGCAGATTCTTCTTCTGGTGGGTACAAAG CTTGAGCTTATCCTCATGGAGATGGCTCAAGAAATGCACGATCGAACTACAGTGGTTAAA GGGGCTCCCGTTGTAGAGCCAAGCAACAAGTTTTTTTGGTTTAATCGCCCTGAGTGGATT CTCCTCTTAATTCATTTCACATTATTCCAGAACGCTTTCCAAATGGCGTATTTCTTATGG ACATCTATGGGATCTCACATGAAGAAAGCAATTTTCGAGGAGCAAACGGCAAAGGCTCTT AAGAATTGGCAGAAGGCTGCAAAGCAGAGAAAGAAGTTGAGGAAAGCAGGTGATGCTTCT TCCTCAGGGTTTGTAAGTGGGGAAAATACACCAAGCCAGGGTTCATCCCCACTGCATTTG CTTCACAACCAAAAGCACAGGTCCAATCAAGACCTCGAAAGCGTCCTTAATTCCCCGAGA TCGGTATCTTATCAATCTGACACCGATCTCTCGGAGATGGAGGGCTCCGCACATGATGGG AATGGTATAAGAAGATCAGAAGATCAACCTGCAGCACTAAGGAAAGAAGGATCGCACAGC ATTGATTTTTCATTTGTTAAGCCTTGA
PEP MAPAAAGERSLKETPTWAVAIACAVFILISIIIEQAIHALGKWFQKRNKKAMLEALEKIK AELMLLGFISLLLTVGTRYLPKICIPEKYGNTMLPCELESKYKDDGGGKDDGKNKGGGEG DGDENDRRRKLLEFAETMIWRRVLAAPSGGDSSACSEMKKWKAWESETSSLEYQFTNDPS RFRFTRQTSFVKRHSGFSTMPGIRWIVAFFRQFIGSVTKVDYLTMRHGFINAHFAPNSKF DFHKYIKRSMEDDFKIVVEWHAFTWLSLAPLIVSASFFFFFKSSIINTFVLQILLLVGTK LELILMEMAQEMHDRTTVVKGAPVVEPSNKFFWFNRPEWILLLIHFTLFQNAFQMAYFLW TSMGSHMKKAIFEEQTAKALKNWQKAAKQRKKLRKAGDASSSGFVSGENTPSQGSSPLHL LHNQKHRSNQDLESVLNSPRSVSYQSDTDLSEMEGSAHDGNGIRRSEDQPAALRKEGSHS IDFSFVKP


| Top |