Cherry SNP DataBase

Gene information

Gene Pav_sc0001479.1_g140.1.mk
Chromosome name PAV_r1.0chr7
start 17634971
end 17635300
PAV_r1.0 name Pav_sc0001479.1
start 60346
end 60675
direction -
Annotation NR PREDICTED: uncharacterized protein LOC103449029
Sequence CDS ATGTGTCACCCTCACCCAGGTGTACCTAGTTTGGTTAGGCTGAGAGACTTGGCGCTGCTG CATCACCATGGCAGATGGCTTCTTCTGCAAGGTCCTGCGGTGGTTCAGATTCAGACTTCA GTGGATTGGCATGCAGCTGCTGCTGCAGGCATGAGGGTTGAAGAGGAGGCTGCTGGTGGT GGTGGTAGAAGAGGTGGCAGCGGTGGCCCGACAAGGCAGTGCCTGTGCTCGCCGACCCGG CATCCGGGCTCGTTTCGGTGCAGGCAACACCATGCTGGGTATGTCTGGGGTACTGGTCGG ATTGTGAGAAAAAACAGCTCCACTAATTAA
PEP MCHPHPGVPSLVRLRDLALLHHHGRWLLLQGPAVVQIQTSVDWHAAAAAGMRVEEEAAGG GGRRGGSGGPTRQCLCSPTRHPGSFRCRQHHAGYVWGTGRIVRKNSSTN


| Top |