Cherry SNP DataBase

Gene information

Gene Pav_sc0001488.1_g150.1.mk
Chromosome name PAV_r1.0chr3
start 9054620
end 9056419
PAV_r1.0 name Pav_sc0001488.1
start 80319
end 82118
direction -
Annotation NR PREDICTED: armadillo repeat-containing protein 7
Sequence CDS ATGTTTACGAATGAACGGAGGCAAGAAGAGCGAACTGGAAGATCTGGAACTCCAAGGCTG CAATACCTTCAGGAATTGGTTTCTCAATTTCAGAATACAGCAGATGATGAAGAGACAAAA GAGAAAATTGTTGCTAATTTGGCCAACTTTGCTTATGATCCTTACAACTATACCTTCTTG CGGCAGCTCAATGTGTTGGAACTTTTTGTGGACTGCATAACAGAACCGAATGAGAAGCTG GTGGAATTTGGTTTAGGAGGAATCTGCAATTGCTGCGCCGATCCGGCAAATGCCATAATT ATCACGCAGTGTGGTGGGATCCCTCTTGTTATTCAATGTTTATCAAGCCCAGTTAGAAAC ACTGTGAATTATGCAATTGGATCACTTTATTATCTATGCAACGCATCTAACAAGGGGGAG ATTATGAAGCCAGAGGTGGTTGATGTCATGAAGAGATATGCTGCAGCTGAAGAAGTGAGT GTCAGTTTCAGTAATCTAGCCAAGGCATTTTTGGACAAACATGTTTCTGAAACTGCTTAG
PEP MFTNERRQEERTGRSGTPRLQYLQELVSQFQNTADDEETKEKIVANLANFAYDPYNYTFL RQLNVLELFVDCITEPNEKLVEFGLGGICNCCADPANAIIITQCGGIPLVIQCLSSPVRN TVNYAIGSLYYLCNASNKGEIMKPEVVDVMKRYAAAEEVSVSFSNLAKAFLDKHVSETA


| Top |