Cherry SNP DataBase

Gene information

Gene Pav_sc0001488.1_g160.1.mk
Chromosome name PAV_r1.0chr3
start 9057316
end 9061317
PAV_r1.0 name Pav_sc0001488.1
start 83015
end 87016
direction +
Annotation NR PREDICTED: protein furry homolog-like
Sequence CDS GATGGGCAATATCCCCGACCTTCTGACCCTGCTTATGAGCAAGCACTGGATTCCTCAGCT ATGGTAGCTCGACATAAATGCATACCTCTTTTAGAAGCACTTCTAAGATGGAGAGAAAGT GAATCCCCAAAAGGTGAAAATGAGGCATCTACATTCCAAAGAAAGCATGCAGTGGAGTGC AATTTTTGTTCAGCATGTATTCGCTTTTTCAAGTGCTGTCCACAAGAAGGACTTACGGAG AAACTTTGGTCTGGGCTTGAAATCTCTTTACCAACAAACACAACCACCCATTTACTCATT CTCTACTCTCGCACAGAACCAAACAACACCCACCAAGAATTTCAAAACATTCTCCCATAT TTTCCAGCAATGCTCCCATGGCAGAGCTCCGAATCCGGGAAAACAAGCCCACGCTCGCAT GATAGTTTCTGGGTTTGA
PEP DGQYPRPSDPAYEQALDSSAMVARHKCIPLLEALLRWRESESPKGENEASTFQRKHAVEC NFCSACIRFFKCCPQEGLTEKLWSGLEISLPTNTTTHLLILYSRTEPNNTHQEFQNILPY FPAMLPWQSSESGKTSPRSHDSFWV


| Top |