Cherry SNP DataBase

Gene information

Gene Pav_sc0001513.1_g050.1.mk
Chromosome name PAV_r1.0chr7
start 4569260
end 4571994
PAV_r1.0 name Pav_sc0001513.1
start 31148
end 33882
direction +
Annotation NR PREDICTED: mitochondrial fission 1 protein A
Sequence CDS ATGGAACAGATGTTTGACAAATTTTTTGACTCCATCGCTAACCTTTTCGGCGGCGGAGAT TCGATCCCCTGGTGCGACCGCGACGTCATCCACGGGTGCGAGAAAGAAGTTGCGGAGGCC AACAAGGGTGACTCAGATGAGCAGAAGAGCGAAAGCATAATGAGGTTATCATGGGCACTT GTCCACTCAAAGCAACCAGAAGATGTGCAGCGTGGAATTGCCATGCTTGAAGCTTCATTG GCCAACACTAGCTCCCCTTTGCATCAGAGAGAGAAGCTTTACCTTCTGGCTGTTGGATAC TACAGAACTGCTGAATATTCAAATAGTCGGCATCTTGTGGAGCAATGCTTAGAGATTGCT CCTGATTGGAGACAGGCTCTGACCCTTAAGAAGACTGTTGAGGATCAAATTGCTAAAGAT GGCTTAATTGGAATAGGCATTACTGCTAGTGCTGTTGGGCTTATAGCAGCTGGGATTGTT GCAGCGCTGGTTCGCAGGTGA
PEP MEQMFDKFFDSIANLFGGGDSIPWCDRDVIHGCEKEVAEANKGDSDEQKSESIMRLSWAL VHSKQPEDVQRGIAMLEASLANTSSPLHQREKLYLLAVGYYRTAEYSNSRHLVEQCLEIA PDWRQALTLKKTVEDQIAKDGLIGIGITASAVGLIAAGIVAALVRR


| Top |