Cherry SNP DataBase

Gene information

Gene Pav_sc0001513.1_g070.1.mk
Chromosome name PAV_r1.0chr7
start 4560500
end 4564925
PAV_r1.0 name Pav_sc0001513.1
start 38217
end 42642
direction -
Annotation NR PREDICTED: DNA-directed RNA polymerase V subunit 5A
Sequence CDS ATGGAAGGTGACGCAGAGGCGAATGGCGATGCCAACGGAGAGATATTAGGGCCTTGCTTG ACTGGTTATGTAGACGACGGTAGCCCAGAGAGCCACAGATACTACCTGTCACGCAGAACC GTGCTGGAGATGATAAGGGACAGAGGCTATTCTGTTCCAAGCCCAGAAATCGACCTCTCT CTCCAAGAATTTCGAGCCCGTCACGGCCAGAATCCGGATGTTGAGCGCCTCCGCTTCTCC GCTACTCATCGCACTGACCCTACTGACAGGATAATGGTCATTTACTGCGGGCCTGGTATC GTGAAGGTTAATGTGATTCGTGGGCTGCATTCTCAGATTGCTAATAAAGACACTTTGAAT GGGCTCATATTAATTACCCAAAACCAAATAACAAGCCAAGCTCTAAAAACTATGGAACTT TATCCATTTAAAACTGAAATATTCCAGATTACTGACTTGCTTGTTAATATCACAAAGCAT GTCTTGAAGCCAAAGCATCATGTACTGACTGAACAAGAGAAACAAAAACTCCTAAAGAAG TACAACATAGAAGAAAACCAGCTTCCCCGACTGTCAAGAAAAGATGCGATTGCACAGTAC TATGGACTTGAGAAGGGGCAGGTAGTGAAAGTTACCTATACTGGTGATATAACCGAGTCA CATGTTACATACCGTTGCATCTGGTGA
PEP MEGDAEANGDANGEILGPCLTGYVDDGSPESHRYYLSRRTVLEMIRDRGYSVPSPEIDLS LQEFRARHGQNPDVERLRFSATHRTDPTDRIMVIYCGPGIVKVNVIRGLHSQIANKDTLN GLILITQNQITSQALKTMELYPFKTEIFQITDLLVNITKHVLKPKHHVLTEQEKQKLLKK YNIEENQLPRLSRKDAIAQYYGLEKGQVVKVTYTGDITESHVTYRCIW


| Top |