Cherry SNP DataBase

Gene information

Gene Pav_sc0001518.1_g060.1.mk
Chromosome name PAV_r1.0chr8
start 8776427
end 8795791
PAV_r1.0 name Pav_sc0001518.1
start 21873
end 41237
direction +
Annotation NR PREDICTED: phosphatidylinositol/phosphatidylcholine transfer protein SFH12-like
Sequence CDS ATGCCAGGAACTCTAGACCGACACCTTAAACCTGTTCTCGAAGAACACTCTGAAGACGAG AGGAAAACAAGGTTTGGGCCTCTTAAGAAGGCAATGAATGCCTCCACCAAGTTAAGGTGT TCCTTGAGCAAGAGGGGTCGAAGGAGCAACAGAGTAATGCCTGTCCCTATTGAGGACAAC ATTGATGCAGAGGACTTACAGGCCGTGGATGCATTTCGCCAAGCACTTATCTTGGAAGAA TTGCTGCCTTCAAAGCATGATGATCATCATATGATGCTAAGATTTTTAAGGGCCAGGAAA TTTGACATTGAGCAAACGAAGAAAATGTGGGCTGATATGCTCCAGTGGAGGAAGGAATTT GGTGCTGACACTATTATGGAGGGGCTTACAAGTTTAAACAAATCTGCAAGGGAACTTATC CAGTGCCTTCAGAAGGTTGATGGTGACAATTATCCTGAGGTTCTGGGAAACAAATACCAA AGCAAGTTGCTTGAAATAATTGATTCTAGCGAGCTGCCAGAGTTTTTGGGTGGTAAGTGC ACTTGTGCTGATAAGGGTGGCTGTATGCGTTCCGATAAGGGCCCATGGAATGATCCAGTC ATCACGAAGATGGTTCAGAATGGTGAGGCCAAATGCAAAAGGACAGCTTTGTCAGGCATT GAGAAGGCAGGCTCAAAGAGATGTGATTCTCTCAACTCAAAAACTGTTCCAGAGGCTGAC AGGAAGTCTCAAGTGAAGCAGCAAAATTTCTCTCCTTCACCTGAAGAAGTTGTAATTACC AAAGAGTGCAATAGGACCTATGAGCACGAGGACTTTATGCCAATGGTTGATAAGGCTATG GATACAACTTTCACTAAATCAATTCAATGTGATAAAATTTCCCCAAACCAAGCTACAGAT AGCTTTCCTGTGCGTTACGCTTGCAGGGATCTGGAAAGACTAAGCAATCAATTTGTTTCT GGAATGATGGTTTTTGTCATGGGTATTTTCACCGTGGTTCGATTGGCACGAAACATGCCT AAGAAACTGGCTGAGGTTGCCCACTATGGAAGCCCTGTTTACTCCACTGGAATGGTGAAT AAAGGCCACCAGTTGCCTGCACCAGCCATCTCCAGCAATGAGTACGTGACGATAATGAAG CGCATGTCCGAATTGGAGGAGAAAGTGAATGTTCTCAGCACAAAACCGGCACTCATGCCA CCCGAGAAAGAGGAAATGCTGAACACCACTCTCAACCGAATCAACGTGTTGGAACAAGAT CTGTCAGAAACCAAGAAGGCACTTGAGGACGCCCTTGTTCGGCAAGAAGAGCTTGTAGCC TACCTTGACAAGAATAAGAAGAAAAGGAAATTTATCCTATTTCGCGCGCGTCGGATTGAG TGGCCTTCGCTGCCATTTCCATGCGCCAGGAGCGGCCTGTTCAACCAACGCGCCACCTTG GTGGCCTTTGCTGCCGCCAGACCACCTCTAATGGAGGAAATTGTGTTGCCCACCATTTCT TGTGCCCAATACATTTTTGACAGAAGAAGATCAATAATTGTTTCTCTTGATCAAATCTCA ACACAACTGGATGAAAACTCTGAGGATGAGAAGAAAACAAAGCTTGGGTCTTTTAAGAAG GCAGCCAACATGATTACAAACTCCTTCAATAAGGGTCGAAGGAATAGCAAGGTAATGTCT TTCCCTATGGAGGATGACATTGATGCAGAGGAGCTAAAGGCAGCTCAGGAACTCCGGCAA GCACTTATCTCGGAAGAACTACTGCCCTCAAAACATGATGATACTCATATGATGCTAAGA TTTCTAAGGGCCCGGAAATTTGACCTTGAGAAAACAAAGCAAATGTGGTCTGACATGCTA CAGTGGAGGCAGGAATTTGGTGCTGACACTATTATGGAGGGGCTTACAAGCTTAAATAAA TCTGCAAGGGAACTTATCCAGCGCCTTCAGAAGGTTGATGGTGACAATTATCCTGAGATA GTTCAGAGTTATCGTGAGGCCAAAAGCACAAGCAACACTCAATCAGGTGATATGGAGGAG AAAGAAGAGAAAGAAGAGAAAGAGGAGAAAGAGGAGAAAAAGGAGAAAGAGGAGAAAGAG GAGAAAGAGGAGAAAGAGGAGAAGACAATCTCTGAACCAGAGAAGACACTCTCTAACAAG GAGAAGATAATCTCTGAAGATGATCAGGCTTGCACAAATAGAATGGATTCTTTCTGCTCA GACACCTTTTTAGAGGCTGAAATGCATGTGGATCATCTCTCCTCTGTGCCTGAAGATCTT TTAACTCCCAGAATATGTAATAGCCCATATTTTGAGGCAATGGTTGACAAGGGAACTGAG AAAGAGGCCGAAAAGCTGAACGCTGCTCTCAACCGACTCAGTGCCTTAGAACAAGAGTTG TCCTCAACCAAGCAGGTTGAGACTCAAAAGGAGGAAAAGCTGAAGGCTGCTCTTGACCGC GTCAATGCTTTGGAACAAGAGCTGTCAGAAGCCAAGAAAGCACTTGATGAAGCCCGCCAT AAACAGGAGGAGCTTCTAGCCTCGGTTGACAAGGAAAAGAAAGTTTATTCTGTTGGTGAG GGGGATCAACGTAAGCATTTATCTCGTGTGGTTGATTTAGTAGTGCAAGTTTGCATGGTT CTCATGAGGGAAGAAGTGGAAATGTCTGCCTATCTGTGTTGGGCTATTTGGGATGACAGG AATTCTACCTTGCATTATTCATGTTATAACAGCAGGCATTGTTGTTGTGCGAGGAGTTCC AAATTAGCAACCGAAAACCATCCTCCAATATGCAAAGTACTCCTCACAAAATTCACGAAG AAACTTCTGAGGATGAGAGGAAGACAAGGCTTGGGTCTCTTAAGCAGAAGGCAATCAATG CCTCCTCCAAGTTTAGGCATTCCTTTACTAAGAAGGGACGAAGAAACAGCAAGGTAA
PEP MPGTLDRHLKPVLEEHSEDERKTRFGPLKKAMNASTKLRCSLSKRGRRSNRVMPVPIEDN IDAEDLQAVDAFRQALILEELLPSKHDDHHMMLRFLRARKFDIEQTKKMWADMLQWRKEF GADTIMEGLTSLNKSARELIQCLQKVDGDNYPEVLGNKYQSKLLEIIDSSELPEFLGGKC TCADKGGCMRSDKGPWNDPVITKMVQNGEAKCKRTALSGIEKAGSKRCDSLNSKTVPEAD RKSQVKQQNFSPSPEEVVITKECNRTYEHEDFMPMVDKAMDTTFTKSIQCDKISPNQATD SFPVRYACRDLERLSNQFVSGMMVFVMGIFTVVRLARNMPKKLAEVAHYGSPVYSTGMVN KGHQLPAPAISSNEYVTIMKRMSELEEKVNVLSTKPALMPPEKEEMLNTTLNRINVLEQD LSETKKALEDALVRQEELVAYLDKNKKKRKFILFRARRIEWPSLPFPCARSGLFNQRATL VAFAAARPPLMEEIVLPTISCAQYIFDRRRSIIVSLDQISTQLDENSEDEKKTKLGSFKK AANMITNSFNKGRRNSKVMSFPMEDDIDAEELKAAQELRQALISEELLPSKHDDTHMMLR FLRARKFDLEKTKQMWSDMLQWRQEFGADTIMEGLTSLNKSARELIQRLQKVDGDNYPEI VQSYREAKSTSNTQSGDMEEKEEKEEKEEKEEKKEKEEKEEKEEKEEKTISEPEKTLSNK EKIISEDDQACTNRMDSFCSDTFLEAEMHVDHLSSVPEDLLTPRICNSPYFEAMVDKGTE KEAEKLNAALNRLSALEQELSSTKQVETQKEEKLKAALDRVNALEQELSEAKKALDEARH KQEELLASVDKEKKVYSVGEGDQRKHLSRVVDLVVQVCMVLMREEVEMSAYLCWAIWDDR NSTLHYSCYNSRHCCCARSSKLATENHPPICKVLLTKFTKKLLRMRGRQGLGLLSRRQSM PPPSLGIPLLRRDEETAR


| Top |