Cherry SNP DataBase

Gene information

Gene Pav_sc0001529.1_g020.1.mk
Chromosome name PAV_r1.0chr4
start 269647
end 273517
PAV_r1.0 name Pav_sc0001529.1
start 11071
end 14941
direction +
Annotation NR PREDICTED: UPF0329 protein ECU05_1680/ECU11_0050-like
Sequence CDS ATGCAAGTCATTTTGAAGCAAAGCAGGGGCAATTTGGGAGAAGCTGAGTCAGCTAGGACG GAGAAGAAAGAGGAGAAGAAGGAGGAAGAAAAGAAGAAAGAAGGCAAAGACGGAAAGAAA GCAGAAGAGAAAAAGGAAGAAAAGAAAGAAGAAGAGCCTCCGGAGATTCTACTCAAGGTC GATATGCATTGTGAAGCTTGCGCAAGGAAAGTTGCTAGAGCCTTGAAGGGTTTTGAAGGA GTGGAGGATGTAACGACAGACAGTAAGGCAAGCAAAGTGGTGGTGAAAGGCAAAGCGGCA GACCCCATAAAGGTGTGCGAAAGATTACAAAAGAAAAGCGGCAAGAAAGTGGAGCTCATT TCACCTTTACCCAAACCTCCCGAGGAGAAGAAAGAAGAACCAGTTAAAGAAGCTGACAAG GAAGAGAAAAAAGAGGAGCCTCCGGCTGTTGTTACAGTGGTATTAACAGTTCGAATGCAC TGCGAAGCATGCGCTCAACTTTTACAGAAGCGAATCCGAAAGATCAAAGGTGTGGAGTCA GTGGAAACAGACGTCGCTAACGATAAGGTTGTAGTAAAAGGTGTGGTGGATCCTGCCAAG CTTGCTGAGGAGGTGTATAAAAAAACCAGAAAGCAGGTTTCCATTGTGAAGGAAGAAGAA AAGAAGGAAGAAGAAAAGAAGGAAGAAGAAAAGAAAGAAGAGGAGAAAAAAGAAGGAGAA AAGAAAGAAGGGGAGGAAGACAAAGGATCAGAGGATAACAAGTTTGATATCAAGCGGACC GAATATTGGCCAACAAAGTTCTACGCGGATTATTCTTACCCTTCCCCGCAGATTTTCAGT GATGAGAACCCTAATGCCTGCTCCGTTATGTGA
PEP MQVILKQSRGNLGEAESARTEKKEEKKEEEKKKEGKDGKKAEEKKEEKKEEEPPEILLKV DMHCEACARKVARALKGFEGVEDVTTDSKASKVVVKGKAADPIKVCERLQKKSGKKVELI SPLPKPPEEKKEEPVKEADKEEKKEEPPAVVTVVLTVRMHCEACAQLLQKRIRKIKGVES VETDVANDKVVVKGVVDPAKLAEEVYKKTRKQVSIVKEEEKKEEEKKEEEKKEEEKKEGE KKEGEEDKGSEDNKFDIKRTEYWPTKFYADYSYPSPQIFSDENPNACSVM


| Top |