Cherry SNP DataBase

Gene information

Gene Pav_sc0001529.1_g140.1.mk
Chromosome name PAV_r1.0chr4
start 215164
end 227460
PAV_r1.0 name Pav_sc0001529.1
start 57128
end 69424
direction +
Annotation NR PREDICTED: sister chromatid cohesion protein PDS5 homolog A
Sequence CDS ATGGCCCAAAACCTTGAGCAGCAGCTCAAGGAGGTGGGATCGAAGCTCGAAACCCCTCAT TCCTCCAAAGACGCTCTCGTGAAGCTCCTAAAGCAAGCTGCATCATGTCTTTCTGAGCTG GACCAATCGCCTCCAGCATCTACATTGGAGTCAATGCAGCCTTTCCTTAATGCAATTGTC AAGCCAGAACTGTTGAAGCATCAAGATAGAGACGTCAAGCTTCTAGTTGCAACGTGTATT TGTGAGATAACACGGATTACTGCACCTGAAGCTCCTTATAGTGATGAAGTGCTAAAGGAT ATATTTCATTTGATTGTGGGCACTTTTAGTGGATTGAAAGATACAAGTGGTCCATCATTT GGTAGGAGAGTTGTCATTTTGGAGACTCTTGCGAAATATAGGTCATGTGTTGTAATGTTG GACCTTGAATGTGATGATCTGGTGAATGAAATGTTCAGTACATTTTTTGCCGTTGCCAGA GATGATCACCAAGAAACTGTTCTATCATCGATGCAAACAATTATGATTGTTCTCTTAGAA GAGAGCGAGGATTTGCGAGAGGATCTTTTACTTGTTGTATTGTCTATATTAGGTCGGAAT AGAAGTGATATTACTGTGGCTGCTAGGAGGCTTGCCATGAAAGTTATAGAACACTGTGCA GGAAAGCTTGAATCTGGCATTAAACAGTTCCTTATATCATCAATGTCAGGAGACAACAAG TCGGTGAATCATCAGATTGATTACCATGAAGTGATCTATGATGTATATTGTTGTGCTCCC CAAATCTTGTCAGGAGTCGTCCCTTACCTAACTGGAGAGCTACTGACTGATCAGCTAGAC ACTCGTTTGAAAGCGGTTAGTTTAGTTGGAGATCTATTTTCTCTGTCCGGATCTACCATC TCTGAAGCATTTCAGCCAATCTTTTCAGAGTTCTTGAAGAGGTTGACTGATAGAGTTGTG GAGGTTCGCATGTTGGTCCTCCAACATGTCAAGAGCTGTATGCTGTCAAATCCTTTCAGA GCTGAAGCTCCCGAAATAATTTCTGCCCTCTGTGACCGGCTGTTGGACTTTGAAGAAAAA GTACGGAAGCAAGTTGTTGCTGTAATTTATGATGTGGCTTGTCATGCCCTTAACTCTATT CCACTGGAAACTATAAAACTTGTTGCAGAGCGCCTTCGAGACAAATCTTTACTTGTTAAA AAGTATACCATGGAGAGGCTAGCTGAGATATACAGGGTTTATTGTGCAAAGTGCTCTGAT GGTTCAATCCTTTCCAGTGAATTTGATTGGATTCCTGGGAAGATTCTGAGATGTTTTTAT GACAAAGATTTCAGATCAGATACAATTGAAAATGTTCTCTGTGAGTCCCTGTTCCCAACC AATTTTTCAGTCAAAGATAAAGTTAAACATTGGGTGAGGGTCTTCTCAGGATTTGATAAA GTTGAGGTAAAGGCTCTTGAGAAAATACTGGAGCAGAAGCAAAGGTTACAACAAGAGATG CAGAAGTATCTGGCACTTAGGCAGATGCATCAGGACGGTGATGCTCCTGAGATCCAAAAA AAAATTATTTTTTGTTTCCGTATAATGTCACGCTTGTTTGCTGACCCTGCAAAGGCTGAA GAGAATTTTCAGTTTCTTGATCTATTGAAAGATGTTAACATCTGGAAGATTTTAACGAAT CTTGTTGATCCAAACACTAGCTTCCAGCAAGCTTGTACTTTACGGGATGATTTGCTTAAG ATTCTGGGTGAAAAACACCGGCTGTATGATTTTCTTAGCACGCTCTCTGTGAAATGTTCA TATCTACTTTTCAACAAGGAGCACGTGAAGGAAATTCTTCTGGAGATTCTTGCACGCTTT AGTCCATTACTACTCAGTGGGACAGAAGAAGAACTGGTAAATCTGCTTAAAGATGATGAT GAAACTATAAAAGAAGGGGTCTTGAATGTTTTAGCAAAGGCTGGTGGTACCATCCGGGAA CATCTTGCAGTCTCATCAAGTTCCATAGACCTTATATTGGAGAGGCTGTGTTTGGAGGGC AGTCGAAGACAGGCAAATTCAGTTGACAAGGCCCATTTGAGGCTTGCTTCAGCAAAGGCA GTTCTTCACCTGTCAAAGCACTGGAATCATAAAATACCAGTCGATGTCTTCCACTTAACC TTGAAGACTTCAGAGATTAGTTTCCCTCAAGCTAGGAAACTATTCCTGAACAAAGTTCAT CAATACATAAAGGACCGGCTTTTAGATGCAAAATATGCTTGTGCATTCTTTTTTAACATA TTTGGATCAAAGTCAGCGGAGTTCCAAGAGGAGAAACAGAATCTAGCTGACATTATTCAA ATGTATCACCAAACAAAGGCACGGCATCTCTCTATGCAATCTGATGCCAATTCCTTGACT GCTTATCCGGAGTACATCCTCCCATACTTGATTCATGCCCTTGCTCATCATTCTTGCCCT AATATTGATGAATGCAAGGATGTCAAAGCATTTGAAGTGATATACCGGCAATTGCACTTA ATTCTGTCTATGTTGGTGCATAGAGATGAAGATGTCAAGTCAGAATCTATTAGCAACATT GAAAAGGAGGACATTTCTGCTATAATCTCTATCTTTCAAAGTATCAAGTGCTCTGAAGAT ATATGCGATTCAGCAAAGTCAAAGAATTCACATGCTATTTGTGACCTTGGGCTATCAATT ACCAAGCGCTTATCCCCAAAGGAGAATGATTTACAAGGACTGCCTGCATCTGTTCCTCTG CCTTCTATGCTGTACAAACCATATGAAAAGAAAGAAGGAGATGACTCTATGGCCAGTGAA GGGCAAACGTGGTTGGCTGATGACAATGTGCTGGCTCACTTTGAATCTCTTAAGTTAGAG ACTAGTGAAACGGGGTTTTCAGAAATTGCAGATGATGAGCTTTTGAAAGATGGTGAAAGA GATGGAAGTGAGGTGCCTTTAGGAAAAATTATTAAACGCATAAAATCTCAGAATTCCAAG GCTAAAAAGGTGAAAAAGAACAAGGCTTCATCAGCTGATGCAGAGAATGCTGAAAATAGT GTTGATATCTTGAAAATGGTCAGGGATATAAATTTGGATAATTTGGAAAAACCTACTAAA TTTGAGTCAAGCAATGGTCATGAAAATTCTCCAAAAAATAATTTAATGGATCTAAAGTAC CAAAAGGGTAACAAAAGAAAAGCTAGTGATGAAACATCTGTCTCAGTACCTAAACGGAGG AGGTCGTCATCCACTCACAGTGCTTCCAGATCAGCAAGAAGTACTTTAAAGTCTCCTTTA AGTGCTTCAAGGGACGATCCACATAATAGAAAATTGGTTCAAAACACCGAGTCAGATTTG TTGGTATCATGCATCCGGAAGAATGCTACCTCCTCATCACAACGTAAAGGCAGAGCCTCT GACCACGGTCATAATGATGAGGCAAATGAAGTTGGAGAAGCCAGTGACCGTGAAGAGCCT AATGTGCTGGAGGCTGACAAGGATGACCCAAATAGTGACTTCAAGTTTCCCACAGGACCC ATCAAGAAGAGGAAAAGAAAAAGTATTCCTGTTTTGGCAAAGGAAGGTGGAAAAGATGTT GAAGACTTGATTGGTTGCAGAATAAAAGTTTGGTGGCCAATGGATAAGAAATTTTATGAA GGAACAGTGAAGTCTTATGATACGTTAAAGAGGAAGCATGTGATACTATATGAGGATGGA GATGTAGAAGTACTTCGCTTAGAAAAGGAACGGTGGGAGCTCATTGACAAAGGTCGCAAG CCCACAAAGAAGTTTCATTCGTCAAAGAAATCCCCTTCAAAAGAAGTGTCACCTGTTCAA AAAAGTAAAGGCATAGGTGGTTCACGTCAGAACAAGAAATCAATTAAAGCAGTTAAAGGG AGAAGAACGCCGAATAAGAACTTGGACAAGGGCGTATCAAAGAGGAATCATTGGGGAAGT AGGGACAAAGAGGATTCTGATGTGTCGAATGTTGAGCCTGCCCTTACATCTAAAGTTGAT GAAATGAACTCGGATACTTCAGAAGGAGAGGATGCTGAAAAAGTGGATGAAAATGTGACA GATGAGGGGGAATCTGACAAGGAAGTGAAGCCAGTTTCCAAAAGAAAACGATTGGAAGAT GCAGAAGAAAGTCCACATCACACTGAGGAATCCGATGAAGAGAATCCTGATTCTGAAGGG AGGCCTGCTGAAGATATACTGCAAGATGCTCAAAATGGCAATGAGGAGGAACATCATTCA GAAGAGAAACAAGCAGATGAACTCAGCAGAGGCTCAAGAGAGCCTAATGAGGAAGATCCG TCAGATTCTGAAGGGAATCAAGAAAAAGATGACAGTGCTGGTAGTCCCATAAAACAGGAG AAACCCCATGTAGAGCCTTCAAGTCCTGATGATGCTGGGGATCCCGAAATTTCTGATGAT GAGCCTCTTGTACTTGCCTCCAGCCTTGCTTTTACGTACCCTAAACAAAAAAGTTGTGTT AGTGGTGTTTTGAGCTTAGTTGGTTTTAATTGTCTTTTTTCTCCTCTGGATGCAGAGCAA GTGGACGGATCGAGTAGTGAAGAGGGGTTCAAGGCGAGCACGATGAGTGGTCTAATCAAC TTTTACCATTTAGCTTTGCTTGGCAGTGGGCGGGGGCTGCAGATCCTAGTGCAATCAGGT GGCGTTTACAGTTTGGTGTGGAAAGCAGAGGAAAAAGAAGAATGGGAAAAGGCTAATAAA TGTAATGAGCTGCAGTTGGGTTGGGCGTGA
PEP MAQNLEQQLKEVGSKLETPHSSKDALVKLLKQAASCLSELDQSPPASTLESMQPFLNAIV KPELLKHQDRDVKLLVATCICEITRITAPEAPYSDEVLKDIFHLIVGTFSGLKDTSGPSF GRRVVILETLAKYRSCVVMLDLECDDLVNEMFSTFFAVARDDHQETVLSSMQTIMIVLLE ESEDLREDLLLVVLSILGRNRSDITVAARRLAMKVIEHCAGKLESGIKQFLISSMSGDNK SVNHQIDYHEVIYDVYCCAPQILSGVVPYLTGELLTDQLDTRLKAVSLVGDLFSLSGSTI SEAFQPIFSEFLKRLTDRVVEVRMLVLQHVKSCMLSNPFRAEAPEIISALCDRLLDFEEK VRKQVVAVIYDVACHALNSIPLETIKLVAERLRDKSLLVKKYTMERLAEIYRVYCAKCSD GSILSSEFDWIPGKILRCFYDKDFRSDTIENVLCESLFPTNFSVKDKVKHWVRVFSGFDK VEVKALEKILEQKQRLQQEMQKYLALRQMHQDGDAPEIQKKIIFCFRIMSRLFADPAKAE ENFQFLDLLKDVNIWKILTNLVDPNTSFQQACTLRDDLLKILGEKHRLYDFLSTLSVKCS YLLFNKEHVKEILLEILARFSPLLLSGTEEELVNLLKDDDETIKEGVLNVLAKAGGTIRE HLAVSSSSIDLILERLCLEGSRRQANSVDKAHLRLASAKAVLHLSKHWNHKIPVDVFHLT LKTSEISFPQARKLFLNKVHQYIKDRLLDAKYACAFFFNIFGSKSAEFQEEKQNLADIIQ MYHQTKARHLSMQSDANSLTAYPEYILPYLIHALAHHSCPNIDECKDVKAFEVIYRQLHL ILSMLVHRDEDVKSESISNIEKEDISAIISIFQSIKCSEDICDSAKSKNSHAICDLGLSI TKRLSPKENDLQGLPASVPLPSMLYKPYEKKEGDDSMASEGQTWLADDNVLAHFESLKLE TSETGFSEIADDELLKDGERDGSEVPLGKIIKRIKSQNSKAKKVKKNKASSADAENAENS VDILKMVRDINLDNLEKPTKFESSNGHENSPKNNLMDLKYQKGNKRKASDETSVSVPKRR RSSSTHSASRSARSTLKSPLSASRDDPHNRKLVQNTESDLLVSCIRKNATSSSQRKGRAS DHGHNDEANEVGEASDREEPNVLEADKDDPNSDFKFPTGPIKKRKRKSIPVLAKEGGKDV EDLIGCRIKVWWPMDKKFYEGTVKSYDTLKRKHVILYEDGDVEVLRLEKERWELIDKGRK PTKKFHSSKKSPSKEVSPVQKSKGIGGSRQNKKSIKAVKGRRTPNKNLDKGVSKRNHWGS RDKEDSDVSNVEPALTSKVDEMNSDTSEGEDAEKVDENVTDEGESDKEVKPVSKRKRLED AEESPHHTEESDEENPDSEGRPAEDILQDAQNGNEEEHHSEEKQADELSRGSREPNEEDP SDSEGNQEKDDSAGSPIKQEKPHVEPSSPDDAGDPEISDDEPLVLASSLAFTYPKQKSCV SGVLSLVGFNCLFSPLDAEQVDGSSSEEGFKASTMSGLINFYHLALLGSGRGLQILVQSG GVYSLVWKAEEKEEWEKANKCNELQLGWA


| Top |