Cherry SNP DataBase

Gene information

Gene Pav_sc0001539.1_g270.1.mk
Chromosome name PAV_r1.0chr1
start 1376190
end 1383047
PAV_r1.0 name Pav_sc0001539.1
start 162170
end 169027
direction +
Annotation NR PREDICTED: serine/threonine-protein kinase HT1-like
Sequence CDS ATGGATTCAAGGACAAGTGAGAATTTTGAAGGTGACATTGTATCAAAGCAGGTGGATCAC CAGGAAGGCGATATGAAGTTTAACATTAAGGGTACAGGTACAGGAAGCATTAGTTTCAAA GATATGGATCCAAAAATTAAGGGTACAGGAAGCATTAGTAACAAACAGATGGATCCAAAA ATTAAGGGTACAGGAAATATTAGTAGCAAAGAGATGATCTTCAGAGCTGATAAAATTGAT TTGAAGAACATAGATATACAGCTTGAGAAGCACTTGAGCAGGGTTTGGTCCAAAAACATT GAGAGAACCAGGCCTAAGGAAGAGTGGGAGATTGATTTATCTAAATTGGATATAAGATAT GTTGTAGCTAGAGGGACCTATGGTATTGTATACAGGGGTACCTACGATGAACGAGACGTT GCAGTTAAGGTGTTGGACTGGGGGGAGGATGGTTATGCCACAGCTAATGACACTTATGCT GCGAGGGAATCTTTTCAAAAAGAAGTTGCTGTCTGGCACAAGCTTGACCACCCTAATGTT ACAAAGTTCATTGGAGCTTCAATGGGAACTTCAGATATTAAGATTCCTTCAAAAAGCTCT TCAAGTGATGGTCTAGATTCTAATCCTGCAAGAGCATGTTGTGTTGTTGTGGAGTATCTC GCTGGTGGGACACTAAAGCAATACTTGATAAGAAACAGGCAAAAGAAACTTGCCTTTAAG GTTGTGATCCAACTTGCTTTGGACCTGGCTAGAGGTCTTAGCTATCTGCATTCTCAAAAA ATTGTACACCGTGATGTCAAAACAGAAAATATGTTGCTTGATATTCGCAGAAACCTTAAA ATAGCTGATTTTGGTGTCGCTCGTGTTGAAGCTCAGAATCCAAGGGACATGACTGGTGAA ACTGGTACCCTTGGATACATGGCCCCAGAGGTTCTGGATGGTAAGCCTTATAATAGAAGA TGCGATGTCTACAGCTTTGGCATATGCTTATGGGAAGTTTATTGCTGCGATATGCCTTAC CCGGACCTTAGCTTTGCTGATGTATCATCTGCAGTTGTTCGACAGAACTTACGGCCAGAA ATCCCCAGATGCTGTCCGAGTTCTTTTTCAAACATCATGCGCAAGTGCTGGGACGCAAAT GCAGATAAACGTCCTGAAATGGGTGAGGTGGTGAGAATGTTGGAAGCAATTGATACAAGT AAAGGAGGTGGGATGATACCTGAAGACCGTTCTCCGGGCTGTTTCTGTTTTGCCCCTACT CGTGGTCCCTGA
PEP MDSRTSENFEGDIVSKQVDHQEGDMKFNIKGTGTGSISFKDMDPKIKGTGSISNKQMDPK IKGTGNISSKEMIFRADKIDLKNIDIQLEKHLSRVWSKNIERTRPKEEWEIDLSKLDIRY VVARGTYGIVYRGTYDERDVAVKVLDWGEDGYATANDTYAARESFQKEVAVWHKLDHPNV TKFIGASMGTSDIKIPSKSSSSDGLDSNPARACCVVVEYLAGGTLKQYLIRNRQKKLAFK VVIQLALDLARGLSYLHSQKIVHRDVKTENMLLDIRRNLKIADFGVARVEAQNPRDMTGE TGTLGYMAPEVLDGKPYNRRCDVYSFGICLWEVYCCDMPYPDLSFADVSSAVVRQNLRPE IPRCCPSSFSNIMRKCWDANADKRPEMGEVVRMLEAIDTSKGGGMIPEDRSPGCFCFAPT RGP


| Top |