Cherry SNP DataBase

Gene information

Gene Pav_sc0001556.1_g060.1.mk
Chromosome name PAV_r1.0chr8
start 2202705
end 2206268
PAV_r1.0 name Pav_sc0001556.1
start 24864
end 28427
direction -
Annotation NR PREDICTED: receptor-like protein kinase 2
Sequence CDS ATGTCAAGCAATGCAATCACTATTATTCTCTTGCTTCTCAATATCTCTTTGTTTCCTGCC ACCTCTGCTCTGAACCAAGAGGGCCTCTCCCTACTTTCATGGCTTTCAACCTTTAATTCT TCTTCCTCTGCTGCCTTTTTCTCTTCATGGAATCCAGCTGACCAGGATCCATGCAAATGG GATTATATCATATGTTCCAGCAGCAGGTTTGTTTCCGAAATCACAATCACCTCACTCAAT GTTCCTACCAGTTTCCCAAGCCAGCTCCTCTCCTTCAACTATCTTACCACCCTTGTACTC TCAAATGGGAACCTCAGCGGAGAAATTCCACCCTCGATTGGAAACTTGTCTTCGCTTACC ACCCTGAATCTCAGCTTCAATGCTCTAACAGGTAAAATTCCACAGGAGATAGGAAAGTTA TCCAAATTGCAGTTATTATCACTGAATTCCAATTCCTTGCATGGTGTCATTCCAAAAGAA ATTGGAAACTGTTCACAGCTTCAACAACTTGAGCTGTACGATAACCAGCTATCCGGAAAG GTTCCTGCAGAAATAGGCCAGTTATCAGCTCTGGACATCTTCCGCGATAACCAGCTATCC GGAAAGGTTCCTGCAGAAATAGGCCAGTTATCAGCTCTGGAAATCTTCCGTGCAGGCGGG AATCCTGGAATTCATGGGGAAATTCCAATGCAGATATCAAACTGTGCTTTAGGGAACTGT TCACATTTGATAGTGATCGATTTCTCAATGAATCTTCTGAGTGGTGGGGTTCCTCCTTCT CTTGTAAATTTGGTGGCGTTGGAGGAGTTTCTGCTGTCTGAGAATAATATATCAGGCAGC ATACCACCTTTATTTGGAAACCTTTCCAGTTTAAAGCAACTGGAATTGGACAACAACAGA TTTACTGGCAAGATTCCACCTGTCATTGGGAAACTAAAAGAACTTACTCTGTTCTTTGCC TGGCAGAATCAGCTGCATGGAAGCATACCAACTGAGCTGGCCAATTGTGAGAAACTTCAA GCTTTGGACCTTTCACACAATCTCCTCAATGGGTCAGTTCCAAGTTCTCTCTTTGACCTC AAGAACTTAACTCAATTGTTGTTGATATCAAATCAACTTTCAGGAGTTCTTCCAACCAAT ATTGGTAACTGCACCAACTTGATCCGCTTACGGCTGGGATCAAACAACTTCACAGGTCAA ATTCCATCTGAACTTAGGCTCCTTCATAGATTGACCTTCCTTGAATTGTCAGAAAATCAA TTTAATGGGGAAATTCCTCCTGCAATTGGAAACTGTACCCAGTTAGAAATGGTTGATTTG CATGGCAATGAGCTCCAAGGCATGATTCCTTCATCTTTCCAATTCCTTACTGGTCTTAAT GTTTTAGACCTTTCCATGAACATGATAGAAGGAGCGATTCCTGAAAATTTGGGCAATCTG ACATTCCTAAACAAACTGGTCATCAGTGGAAACCACATTACAGGTTCCATACCAAAATCA TTGGGCTTCTGTAAGGATTTGCAGCTGTTGGATATGAGCAGCAACAATATCACTGGCTCT ATCCCAGATGAGATCGGACGCTTGCAAGGTCTAGATATTCTCTTGAATCTGAGTTGGAAT TCTCTGACAAGCCCCCTTCCAGAAAGCTTCTCAAATCTCTCGAAACTTGCCAATATGGAT CTCTCCCACAATATGCTGACAGGAAGCCTGAAAGTACTGGGCAGTCTCGACAATCTTGTG TCCCTGAATGTCTCATACAATGACTTTTCTGGTCCACTTCCCAATACTAATTTCTTCAAA GATATTCCATCAACTGCATATGAGGGCAACCCGAAGCTATGCATTAACAGAAATGAGTGC CACTTGAACGGTAACCTGCATGACAAGAAATCCATCAGATATCTAATTGTTTGTGTTCTT CTTAGTGTGACTGCAACTATATTGCTAATGCTTGCTGGAATAGTTTTATTCGTTAGAGTT GCTGGAATCACATTTGGGATGGACGGTAAAGAAGAAAGTCATTTGATATGGGATTTCACC CCATTTCAAAAGCTTAATTTTTCTGTTAATGATATTGTGACTAGACTATCAGATTCAAAC ATCGTGGGGAAGGGTTGCTCAGGAATGGTTTATCGTGTGGAGACTCCGACAAAACAGGTC ATTGCAGTGAAGAAGCTATGGCCGCTAATATTGAGATCAGGGACACAAACCCAAGAGATG CTTCAAGTGCTTGGGGTGGCCCTGCTCTGTGTTAATCCTTGCCCAGAGGATAGGCCAACA ATGAAAGATGTAACAGCAATGCTCAAGGAGATCAGACAAGAAAATGAGGATTGGGAAAAA CCGGATTTTCTGGGAAAAGGAGATGCGCAAGTTACAGTCCACAGTTCCAGCTTCTCCAGG TCATCTGAACCTCTAATTGGATCACCTTCTTGTTTTCCCACAAACCCCTAA
PEP MSSNAITIILLLLNISLFPATSALNQEGLSLLSWLSTFNSSSSAAFFSSWNPADQDPCKW DYIICSSSRFVSEITITSLNVPTSFPSQLLSFNYLTTLVLSNGNLSGEIPPSIGNLSSLT TLNLSFNALTGKIPQEIGKLSKLQLLSLNSNSLHGVIPKEIGNCSQLQQLELYDNQLSGK VPAEIGQLSALDIFRDNQLSGKVPAEIGQLSALEIFRAGGNPGIHGEIPMQISNCALGNC SHLIVIDFSMNLLSGGVPPSLVNLVALEEFLLSENNISGSIPPLFGNLSSLKQLELDNNR FTGKIPPVIGKLKELTLFFAWQNQLHGSIPTELANCEKLQALDLSHNLLNGSVPSSLFDL KNLTQLLLISNQLSGVLPTNIGNCTNLIRLRLGSNNFTGQIPSELRLLHRLTFLELSENQ FNGEIPPAIGNCTQLEMVDLHGNELQGMIPSSFQFLTGLNVLDLSMNMIEGAIPENLGNL TFLNKLVISGNHITGSIPKSLGFCKDLQLLDMSSNNITGSIPDEIGRLQGLDILLNLSWN SLTSPLPESFSNLSKLANMDLSHNMLTGSLKVLGSLDNLVSLNVSYNDFSGPLPNTNFFK DIPSTAYEGNPKLCINRNECHLNGNLHDKKSIRYLIVCVLLSVTATILLMLAGIVLFVRV AGITFGMDGKEESHLIWDFTPFQKLNFSVNDIVTRLSDSNIVGKGCSGMVYRVETPTKQV IAVKKLWPLILRSGTQTQEMLQVLGVALLCVNPCPEDRPTMKDVTAMLKEIRQENEDWEK PDFLGKGDAQVTVHSSSFSRSSEPLIGSPSCFPTNP


| Top |