Cherry SNP DataBase

Gene information

Gene Pav_sc0001557.1_g070.1.mk
Chromosome name PAV_r1.0chr7
start 7606007
end 7608581
PAV_r1.0 name Pav_sc0001557.1
start 12668
end 15242
direction +
Annotation NR PREDICTED: cell division cycle 20.1, cofactor of APC complex-like
Sequence CDS ATGGATTTTGATTTTGCGCATTACATGCTTACTCAAGGTAGGAAAGGTAAGGAAAACCCA TCTAGATATGGAAGAGACTATAGGACGCAGTTGGCAGAGGCTATGAACATGAATCGCACT AGAATCCTCGCTTTCAAGAACAAGCCTACTGCCCCTGTAGAGCTTTTCCCGAGCAACTTC TCTTCTTTGCGACAGGATAAACCGGCAAACCATAAGCCACACAGACACATTCCTCAAACT TCAGAGAGAACACTGGATGCTTCTGACCTTATTGATGATTACTATCTGAATTTGTTGGAT TGGGGAAGCTCCAATGTTATCGCAATAGCTCTTGCAAACACAGTTTATTTGTGGGATGCT ACTGATAGTTCTACTTCGGAACTGGCCACATTTGATGTTGAAAGGGGACCTGTTACCAGT GTCAGTTGGGCTATTGATGGACGCCACATTGCCATTGGACTGGACAATTCCGAAGTACAG CTATGGGATTCAACTGCTAATCAGTATCTGAGAACCTTGAGAGGTTGTCACAGATCACGG GTAGGCTCACTAGCGTGGAACAATCACATTCTTACAACTGGAGGAATGGATGGCCGCATT GTAAACAATGATGTAAGAATTAGATCGCACATTGTTGAGACATACAGAGGACATGAACGA GAGGTTTGTGGGCTTAAGTGGTCGGCCTCAGGCCAGCAATTAGCAAGTGGAGGAAATGAT AACCTGCTCCATATATGGGACAACAGATCAGTGGCACCAACACAGTGGCTTCACAGGCTT GAAGACCATACAGCTGCTGTAAAAGCCCTTGCTTGGTGTCCTTTCCAGAGAAATTTGCTA GCTTCTGGTGGAGGTGGGAATGATCAGTGCATAAAGTTCTGGAACACTCACACAGGTGCA TGCCTGAACTCGGTCGACACTGGCTCTCAGGTCTGTGCTTTGCTGTGGAATATGAATGAA CGAGAACTGCTTAGCTCACATGGGTTTACTCGGAATCAGCTTACTCTTTGGAAATACCCA TCAATGGTTAGAATTGCAGAACTCACGGGTCATACGTCTAGAGTCCTTCATATGGCTCAG AGCCCAAATGGTTGCACAGTAGCATCAGCAGGTGGTGAAACACTGAAATTATGGAATGTT TTTGGGGACCCTGAGGAGGTTAAACCAGCTCCACGACCTCCCAAAGAGCCTTTTGCCCAA GTGAGTCGTATCCGCTGA
PEP MDFDFAHYMLTQGRKGKENPSRYGRDYRTQLAEAMNMNRTRILAFKNKPTAPVELFPSNF SSLRQDKPANHKPHRHIPQTSERTLDASDLIDDYYLNLLDWGSSNVIAIALANTVYLWDA TDSSTSELATFDVERGPVTSVSWAIDGRHIAIGLDNSEVQLWDSTANQYLRTLRGCHRSR VGSLAWNNHILTTGGMDGRIVNNDVRIRSHIVETYRGHEREVCGLKWSASGQQLASGGND NLLHIWDNRSVAPTQWLHRLEDHTAAVKALAWCPFQRNLLASGGGGNDQCIKFWNTHTGA CLNSVDTGSQVCALLWNMNERELLSSHGFTRNQLTLWKYPSMVRIAELTGHTSRVLHMAQ SPNGCTVASAGGETLKLWNVFGDPEEVKPAPRPPKEPFAQVSRIR


| Top |