Cherry SNP DataBase

Gene information

Gene Pav_sc0001608.1_g020.1.mk
Chromosome name PAV_r1.0chr8
start 20201561
end 20208428
PAV_r1.0 name Pav_sc0001608.1
start 6113
end 12980
direction +
Annotation NR PREDICTED: zinc finger CCCH domain-containing protein 31
Sequence CDS CACAGTCGTCACGAGGCTCATGACTATCAAGCGCACGTAGAGCTTACTGCGTCCGAACAT CGCTTTCCTGAGAAAAGGATCGAGGCGCGCGGGAGACTAATAAGCGACTTATTACTCGTC TCTGCTCCTCCGCTTTTGCAAAGAGCAAATAGAGACATTTCCAATCCCCTTCCCTTTATT TTCGTTAGGCAGAGAGAAGACAGATCACCGTCGTCCCCAACGTCGTCGTGTAGCTCCTCC TACTCCTCGTCGTTTTCGAACGCCAAATTCTCGTCTCTTCCAGTAATGGCGCTCCGCGAA AAAATCGTGGAGAAAATTCTCGATAATCGCGTCACTCTCATCGTCGGCGAGACTGGTTGT GGGAAAAGCTCGCAAGTTCCGCAGTTTCTTCTAGAGGCGAATTTGAAGCCCATTCTATGT ACACAGCCTAGGAGATTCGCCGTAGTAGCTGTTGCTAAAATGGTGGCAAAAGCTCGAAAT TGTGAAATTGGTGGAGAGGTTGGATATCACATAGGCCATTCAAAGCACTTATCACCAAGG TCTTCGATTGTTTTTAAAACTGCTGGAGTTCTATTGGATGAAATGCGAGATAAGGGGATG CATGCGCTTGATTACAAGGTCATTGTTCTTGATGAAGTGCATGAAAGATCGGTGGAATCA GATCTTGTTCTTGTTTGTGTGAAGCAGTTTATGTTGAGGAATAACAACTTGAGGGTGGTT TTGATGTCTGCAACTGCTGATATTGCAAGATACAGGGATTACTTTAAGGATCTTGGCAGA GGTGAACGAGTGGAAGTGCTTGCAATCCCTACGTCCAATCAGAAAGCCATTTTTCAGCGA AGGGTTGCTGGTCTTCTCAATATCGATTCAGAGTCGCTTTCTGATAGTTATTGTTCAGGT CCAAGTCCTTCTATGGCCAAAGCTGATATTAAGACTAAAGTGCACAAACTTATTCATGAT TTGGTGTTGCATATTCATGAGCATGAACCAGACATTGAAAAGAGCATTTTGATTTTTCTT CCAACATACAATGCACTGGAGCAGCAATGGTTCCTTCTGAAGCCATTTAGTTCATCTTTT AAAGTTCACATTTTACATAGCAGCATTGACACTGAACAAGCTCTCATGACTATGAAGATT TGGAAATCCCATCGTAAAGTGATACTGGCCACAAATATTGCAGAGTCGTCAGTAACAATA CCCAAGGTGGCCTATGTTATTGATTCATGCCGATCTTTACAAGTTTTTTGGAACAGTTAT CAGAAAAAGGAATCTGCAAAGCTTGTTTGGGTTTCTAAGTCTCAGGCCGATCAGCGTAGA GGGAGAACTGGTCGAACTTGTGATGGCCAGATTTATCGGTTGGTTACTAGACCATTTTTC ATCCAGTTTGACGAATACGAGGGTCCCTCTGTACTGAGGTTATCATTGCGGCTGCAAGTG CTTCAGATCTGCTGTGCTGAATCTAAGGCCATTAATGATCCCAAAGCTTTGTTGCAGAAG GCTCTAGATCAACCACATCCTGAAGTTGTTGAAGATGCATTGGATTTGCTTGTTCATATG AAAGCATTAGAAAAAACATCTCCAAGGGGCCGGTATGAGCCGACATTTTATGGGAGGTTG CTTTCCAGTTTGTCATTGTCTTTTGATGCTTCTCTGGTTGTACTCAAGTTTGGAGACATT GGAATGCTGCGTGAAGGCATTCTTCTGGGCATATTAATGGACACACAACCTCTACCTATC CTTCGTCCTTTTGGAGATGAAATTTTGTTTGCAGAATATGCTGACAGCTACTTTTGTGGA GATGATGGCAATACTGGCCTAACTGGTAGGAAGGAGATGGTATTCATGGCAAACTTGTGT GCATTTCAATTTTGGCAACGTGTTTTCAAGGATAACCACCGTGTTGAGCATTTGAAGCAA CTTCTTAAGTTTGATGAGATGAAAGCTACTGCGTTCCTGCTTCCCGAGATTGAAGAAGAT TGGTGCTCTTTCCATAATCTTGTGCAGTCGTCACTAAAACATGTATCTGAAATATATGAA GATATACTAGATTCAGTGCACCGGTATCGGCCCAAGTTTTTGTCTACATCTAATGGCCTT CCATCCTACTATGATCCTTATGAATTTGAGCATAAATGCCTCCTTACATGTCAACAACCA AATGAAGATACAGATGCTCTTGCTACAGATGATAAGCACCTTGAGCCATCTAGTGAAACA ATGAAATGTATCGCTGTACCTTTTGTTGCTCCAAATAACTTCCAAAACAACGATGTGGCA AAAAAGTTGGCAACCATAATCAAACAGATACGAGTCCAGCATACAGAAGATATATCTAGT AATCAGGATTTAGATGTTGATGATGGCTATCATGTCAATGGGGAGGCTTCTATTTGTATA TATTTTGTTAATGGATCCTGCAACAAGGGCAGTCAATGCCTGTTTTCTCATTCACTTAAA GCAAAGAGACCCCCATGCAAATTTTTCTATTCTGCCCAGGGTTGTCGATATGGAGCATCA TGCTTCTTTTCTCATGATGAGAGTTCATCAGTGACATCATCTAACTCAACTCTATGCCTG CCAGAAGGTGGAGAAGCCAAAGCTACATCGCTTATACGATTGTTGCCCACTGATGGATGC ATTCTCTTATTGGATGACACCAATCTACAATTTTCCTCAAATTTTGCTAGACATTATGAT CCATCAAAAATAGTTTCTACCACTAGTTTGTCAGACACATCCATATTTGACTCATCACTG ACTGGTGTCAAAATTTTGTGGGGGCTCTATCATCCGTATGGGACAATCATTTCCAAAGCA GGGGAGAGCCAAATCCCATGGAACGAAGTTAAGTGTGTGCTATGGTTTCCTAATTTTGAT AGCTACAGTGAGAACTTAGATAGACAGAAGCTTCTCTTGCAGAATTTCTTCGAGTATCTT GCCGTCCGAATGCTGGCTGATGACTTGGACAATGTGCGAGTTATTCTCACTATGAACAAT ATCAGGTTTGCACAGCTGCAGGTGGAAAAGTTGGGCAGGGAGAGCTTCTTCTTCCTTACA GAGTCATTTCCATTTGATGACGCCAGCTTTGGGGAGTTGCCAGACAAAGTCAGCACAAAT AAGCCGATGATGGTTTCGAGGCCCATTTCGTACGTTTTTGACTTGCACCCACCTTCAGAC ATTCAGTTTGGTGACTATGCAGCCGGACTTCACAGTTTTCTTCACCATGAGATCCAGGAA GATGTGTAA
PEP HSRHEAHDYQAHVELTASEHRFPEKRIEARGRLISDLLLVSAPPLLQRANRDISNPLPFI FVRQREDRSPSSPTSSCSSSYSSSFSNAKFSSLPVMALREKIVEKILDNRVTLIVGETGC GKSSQVPQFLLEANLKPILCTQPRRFAVVAVAKMVAKARNCEIGGEVGYHIGHSKHLSPR SSIVFKTAGVLLDEMRDKGMHALDYKVIVLDEVHERSVESDLVLVCVKQFMLRNNNLRVV LMSATADIARYRDYFKDLGRGERVEVLAIPTSNQKAIFQRRVAGLLNIDSESLSDSYCSG PSPSMAKADIKTKVHKLIHDLVLHIHEHEPDIEKSILIFLPTYNALEQQWFLLKPFSSSF KVHILHSSIDTEQALMTMKIWKSHRKVILATNIAESSVTIPKVAYVIDSCRSLQVFWNSY QKKESAKLVWVSKSQADQRRGRTGRTCDGQIYRLVTRPFFIQFDEYEGPSVLRLSLRLQV LQICCAESKAINDPKALLQKALDQPHPEVVEDALDLLVHMKALEKTSPRGRYEPTFYGRL LSSLSLSFDASLVVLKFGDIGMLREGILLGILMDTQPLPILRPFGDEILFAEYADSYFCG DDGNTGLTGRKEMVFMANLCAFQFWQRVFKDNHRVEHLKQLLKFDEMKATAFLLPEIEED WCSFHNLVQSSLKHVSEIYEDILDSVHRYRPKFLSTSNGLPSYYDPYEFEHKCLLTCQQP NEDTDALATDDKHLEPSSETMKCIAVPFVAPNNFQNNDVAKKLATIIKQIRVQHTEDISS NQDLDVDDGYHVNGEASICIYFVNGSCNKGSQCLFSHSLKAKRPPCKFFYSAQGCRYGAS CFFSHDESSSVTSSNSTLCLPEGGEAKATSLIRLLPTDGCILLLDDTNLQFSSNFARHYD PSKIVSTTSLSDTSIFDSSLTGVKILWGLYHPYGTIISKAGESQIPWNEVKCVLWFPNFD SYSENLDRQKLLLQNFFEYLAVRMLADDLDNVRVILTMNNIRFAQLQVEKLGRESFFFLT ESFPFDDASFGELPDKVSTNKPMMVSRPISYVFDLHPPSDIQFGDYAAGLHSFLHHEIQE DV


| Top |