Cherry SNP DataBase

Gene information

Gene Pav_sc0001608.1_g030.1.mk
Chromosome name PAV_r1.0chr8
start 20208899
end 20213157
PAV_r1.0 name Pav_sc0001608.1
start 13451
end 17709
direction +
Annotation NR PREDICTED: uncharacterized protein LOC103333959
Sequence CDS CTAGAACCCCGGCACCCAATCGATTCGTGCGCATTTCAGCTCCATAGCTGGAGACCTTTT CAGCTGCATCAACAGACAACACCTACCTCCAAAGCCCTAGACTCCGATCCCTCCCTCCCC AACCCCAAACCCTACAACTCCTCTTCCAATGGCCTGGTGGTCCACACCAAGCGTCCCTGC CTATCCAACCGAGCGACGTCGTTTTCAATCGACGCCATCGACATGTCTCGGTTCTATGCA GCCGGACTTCACACCCTAGAACCCCGGCACCCAATCGATTCGTGCGCATTTCAGCTCCAT AGCTGGAGACCTTTTCAGCTGCATCAACAGACAACACCTACCTCCAAAGCCCTAGACTCC GATCCCTCCCTCCCCAACCCCAAACCCTACAACTCCTCTTCCAATGGCCTGGTGGTCCAC ACCAAGCGTCCCTGCCTATCCAACCGAGCGACGTCGTTTTCAATCGACGCCATCGACATG TCTCGGTTGACCTTGGTAGACGACGACAGGACGATCTCCGGTGGCCATCACAATAAGCAC GGCAGCTTTCGATTCATTGCGAAGAAGAGGCGGCGCCACGGGTCCAGGTCAGTTTCGGGT CGGAGCAGCGATCGGAGTGGGACCCGGAGGTGCTGCTCGGTCGGGGCTTCGGCTGCGTAC GGTACGTGCTCGGATTTTCCGGTGGCGGTGGGTACGGACTCCAGTGGTGAGCTGTTTGGG AATGGGGATGCAAATTGGGCATCGGATGTGAGTGAAGCTAGGAATTCGAGGAAGGAGAGA GATGGAGGGAGTGGAGAGAAGGAGAATCTGGGTATTGGGTTTGGGCCTATTGGGGGTTTT GATGTTCAGGGGAATGAGTCCGGGTACGGCAGTGAACCGGGTTACCGAGGGGATGCGGAG TTCGGGTACGGCGATGAGCTTGATGAGGAGGAGGAGGATACTCGTCTGTTGTTTTGGGGT GATCAATTTGGAGATGCGGATTCCATGATGGAGATTGTGGGGGAAAATACATTTGTCGAT CAAAAATCTCATCACAGATGTCGGCGTAAGAAGCACGACTGCAGAATGGTTGATTCGCTG AGAGAGAGGAGACTGAGGGGGAGAGACGGGGCTGAGATGGCGAGAGCAGAGGCATTGAAC GCGTACAGGGCGCTGCTAAGAGCGACTCGGAAGTCGTTCGCCGGAGACACACCGATGCTA AACGGGTCGGCGGCGGAGGTCCGCAAGAAGTTCGAAGAGAATAGGCACGTGACCTCGGAT GTGGAGATCCAGAGACTCCTGGAAGAGGCACGTGAGGCCTCCCTTTTCATCACCCAAATG ATCGTCCAGGCTAAGCTCAATTCTCGTGGCGGTTACGAAGTGAAGGCAGACAAAGATCAT GCGGGAGCAACGCTTGAGGTTCCTTCTGAAGAACTTCTTCCCAAGTCTTGA
PEP LEPRHPIDSCAFQLHSWRPFQLHQQTTPTSKALDSDPSLPNPKPYNSSSNGLVVHTKRPC LSNRATSFSIDAIDMSRFYAAGLHTLEPRHPIDSCAFQLHSWRPFQLHQQTTPTSKALDS DPSLPNPKPYNSSSNGLVVHTKRPCLSNRATSFSIDAIDMSRLTLVDDDRTISGGHHNKH GSFRFIAKKRRRHGSRSVSGRSSDRSGTRRCCSVGASAAYGTCSDFPVAVGTDSSGELFG NGDANWASDVSEARNSRKERDGGSGEKENLGIGFGPIGGFDVQGNESGYGSEPGYRGDAE FGYGDELDEEEEDTRLLFWGDQFGDADSMMEIVGENTFVDQKSHHRCRRKKHDCRMVDSL RERRLRGRDGAEMARAEALNAYRALLRATRKSFAGDTPMLNGSAAEVRKKFEENRHVTSD VEIQRLLEEAREASLFITQMIVQAKLNSRGGYEVKADKDHAGATLEVPSEELLPKS


| Top |