Cherry SNP DataBase

Gene information

Gene Pav_sc0001613.1_g240.1.br
Chromosome name PAV_r1.0chr4
start 18431903
end 18434644
PAV_r1.0 name Pav_sc0001613.1
start 84669
end 87410
direction -
Annotation NR PREDICTED: ervatamin-B-like
Sequence CDS ATGGAACTGAAAGAAGCTACCCCAATTGATGATCAGAAGGGGAGTGAGATAATGCTTCTT GAAAACCCATTTGCAAGGGCAGAACTTGAGGAGCTGAGAATTGGGGATCAATCTTTGCTC AAGTTTCAGAAGTTGCAGAAATCCAAGGATGCAGTGTTTGTTTCTGTGCCAAGTAACCAA GATGGGTTGATGAAGAATCAAGCAAATGTGCGGAAAGAAGAGGAAGAAGAGGCTCTGAAT CTGAAGTTGGAGAAACAGAGAAAGCTGAAAGAATCCAAGAAGGAGAATAACAATTACTTG GGAGGAGCAAAAGAGCAATCTTGGGAACTGCTTGGAGGAACCAAGAGGAAATCAAATATG GTTCTCAAGATAACTGGTGCATGGTGCAGATATGGAGAGAATAATAGACAGAAAGAAGTG GAAGAAGCTCCAGAGTTAAATAAATCAAGAATGCCGAATTGCTACTTCTCTGGCACTGAT TCTGAAGCAGTAGCATCTTCTGATCCTTTGCCTGCAGATGCATTGAAGATTCGTATTAAG AACAAGTTTCCCACAGCCACAGACTTGAAGTTGAAGTTGAAGGAAACCAAATCCGAAATC CTGAGTGCACGAGACAAGGATTTGCTGGTCATGATGTTGGGTGCATGGTCTTCTGAAGCC ACTTCTCGCAGTCTTCAAGATGCATCATCCATGCATGGGAGACACGAAGAATGGATGGCT CGTTACGGGCGTGTATATACCGACAATGAAGAGAAGGAAAAGCGTTTCAAGATATTTAAG GAAAATGTTGCATATATAGAATCTTCCAACGCCGATGCAAGCAAACCTTACAAATTAAGA GTCAATCAATTTACAGACCTTACAAATGAAGAATTCATAGCCTCAAGAAATAGATTTAAG GGGCATGAATGTTCCACAAAAACGACGTCTTTCAAGTATGAAAATGTAGCATCAGTGCCA GCTACGATGGATTGGAGAAAGAAAGGAGCTGTAACACCCATCAAGGACCAAGGCCAATGT GTGGCAGCTACGGAAGGAATTACTCAACTTACAACTGGTAAACTGGTCTCTTTGTCTGAG CAGGAGCTTGTTGATTGCGACACCAAAGGTGTAGACCAAGGTTGTGAGGGTGGTTTAATG GATGATGCCTTTCAGTTCATCCAACAAAATCATGGGCTTAGCACGGAAGCTAACTACCCC TACAACGGTGTTGATGGTACATGCAACACCAAGAAGGAAGCTAACATTGCAGCCAAGATA ACTGGCCACGAAGATGTTCCTGCAAACGATGAAAATGCCCTTCTTAACGCTGTCGCTCAT CAACCTGTTTCTGTTGCCATTGACGCTAGTGGTTCTGACTTCCAATTCTATTCAAGTGGT GTCTTTACAGGAACTTGTGGAACGAGCCTAGACCATGGTGTTACGGCTATTGGTTATGGA GTCAGTGATGATGGGACTAAGTATTGGTTGGTGAAAAACTCATGGGGCACGGAATGGGGT GAAGAAGGATACATAAGAATGCAAAGAGATGTTGATGCTAAGGAAGGCCTATGTGGCATT GCTATGGAAGCCTCTTACCCTACTGCATAG
PEP MELKEATPIDDQKGSEIMLLENPFARAELEELRIGDQSLLKFQKLQKSKDAVFVSVPSNQ DGLMKNQANVRKEEEEEALNLKLEKQRKLKESKKENNNYLGGAKEQSWELLGGTKRKSNM VLKITGAWCRYGENNRQKEVEEAPELNKSRMPNCYFSGTDSEAVASSDPLPADALKIRIK NKFPTATDLKLKLKETKSEILSARDKDLLVMMLGAWSSEATSRSLQDASSMHGRHEEWMA RYGRVYTDNEEKEKRFKIFKENVAYIESSNADASKPYKLRVNQFTDLTNEEFIASRNRFK GHECSTKTTSFKYENVASVPATMDWRKKGAVTPIKDQGQCVAATEGITQLTTGKLVSLSE QELVDCDTKGVDQGCEGGLMDDAFQFIQQNHGLSTEANYPYNGVDGTCNTKKEANIAAKI TGHEDVPANDENALLNAVAHQPVSVAIDASGSDFQFYSSGVFTGTCGTSLDHGVTAIGYG VSDDGTKYWLVKNSWGTEWGEEGYIRMQRDVDAKEGLCGIAMEASYPTA


| Top |