Cherry SNP DataBase

Gene information

Gene Pav_sc0001613.1_g420.1.br
Chromosome name PAV_r1.0chr4
start 18352145
end 18358028
PAV_r1.0 name Pav_sc0001613.1
start 161285
end 167168
direction -
Annotation NR PREDICTED: ABC transporter B family member 11-like
Sequence CDS ATGACGAACAGGGATCATGACAAGAGCAGCAATGGAGGAGACGAGAAAACTGAAAAAGTT GCATTTATAAAGTTATTTTCGTTTGCAGATAAGACTGATATTATGTTGATGCTCGTCGGC ACGATTGGTGCAATGGGGAACGGTTCATGGGAAAGACAAGCTGCAAGGATAAGGGCTTTG TATTTGAAAACAATATTGAGGCAAGATGTTGCTTTCTTTGATATGGAAACAAACAGTGGA GAGGTCATTGGGAGAATGGCCAGCGATACTGTTCTCATACAAAATGCCATGGGTGAGAAG GTTGGGAAATTTGTCCAGCTATTTTCAACATTCATTGCAGGGTTTATAATAGCATTCATC AAAGTGCGGCTTCTTACCCTTGTCATGTTATCCTGTGTTCCTGTGCTTGTGGCAGCTGGT GCATCTATATCCTTCATTGTAACCAAGATGGGATCCCGTGGACAAAGTGCTTACGCAAAA GCAGCAAACGTTCTTGATCAGACGATAGGCTCCATTAGAACAGTTGCATCCTTTACTGGA GAGAAGAAAGCTATTACAAGTTACAATAAAAATCTTGTGGATGCTTACAAATCAGGTGTT CATGAAGGTTCGGCTGCTGGAATAGGTTATGGTTTGGTTATGCTAGTTCTGTTCTTCTCT TATGCCTTGGCTGTATGGTTTGGTTCAAGAATGATAAGGGAAAAAGGATATTCCGGGGGT GATGTGCTGAATGTGATTCTTGCTGTTTTGACTGCATCCATGTCTCTGGGGCAGGCATCA ACGTGCTTAAGTGCATTCGCCGCTGGTCAAGTTGCAGCATTTAAGATGTTTGAGACTATC AGTAGGAGGCCAGAGATTGACGCCTATGACAAAAAAGGAAAGACATTGAATGACATTCGT GGAGATATAGAGTTGAGAGAGGTATTTTTCAGTTATCCAGCCAGACCAGATGAACAAATA TTCAACGGGTTCTCACTTTATATCCCTAGTGGCACCACCGCAGCTTTGGTTGGAGAAAGT GGAAGTGGGAAGTCAACAGTCATCAGTCTGATAGAGCGGTTTTATGATCCAAGAGCTGGT GAAGTTTTGATAGATGGTATAAACCTGAAAGAATTTCAGCTCAAATGGATTCGGAGTAAA ATTGGTCTTGTCAGCCAGGAACCTGTGCTGTTTGCATCCAACATTAAGGAAAATATTGCC TATGGAAAAGATGGTGCTACTCTTGAAGAGATAAAAGCAGCAGCTCAACTTGCAAATGCT GCTAAATTTATTGATAAACTGCCCCAGGGGTTTGACACCATGGTGGGTGAGCATGGAACT CAGCTGTCTGGTGGGCAGAAGCAGAGAATTGCTATAGCAAGAGCAGTTTTGAAAGATCCA CGAATTTTACTTCTGGATGAAGCTACAAGTGCACTTGATGCAGAATCTGAAAGGATAGTT CAAGAAGCATTGGATAGGATTATGGTCAACCGAACTAGTGTTATTGTTGCTCATCGTTTG AGCACGGTGAGGAACGCAGATACAATTGCTATCATTCATAAAGGAAAGATGGTTGAAAGA GGCTCGCACTCAGACTTACTCAAGGATCCTGAAGGAGCATACTCTCACCTTATACGCTTG CAAGAAGTAAACAAGGGATCAGAACAAACAGCAGAAGCTCAAAACAAATCTGAAATTACT ACGAAATGTTTTAGACAGTTGAGTCAAAGGATGGTGTTAGTAAGATCCTTAAGTCGGAAT TCCTCCGTTGGTAGCATGCGTGAGAACAATACATTGCAGGCAGACCCAGAAGCCCCTGTG CTGCCATTAGAGCAACCTCCAAAGATCTCACTGCGCCGTCTTGCTGTCCTCAATAAGCCT GAGATTCCAGTGCTTCTTATTGGAACTGTAGCTGCAATCATCAGTGGTGTTATGATTCCA ATTTTTGGTTTGCTTTTGTCCAAGGTAGTAAAGACTTTCTATGAACCACCTCTTCAACAA AAGAAAGATTCAGAGTTTTGGGCAATTATGTTTATGACCCTTGGTGTGGCATCGTTATTG GTGATCCCAGCAAGAGAATACTTCTTTTCTGTGGCTGGTAGTAAGTTAATTGAACGTATC AGATTGATTTGTTTTGAGAGAGTGGTTCACATGGAGGTTGGGTGGTTTGATGAGGCTGAG AACTCAAGTGGTGCAATTGGTGCCAGGCTCTCAGCAGATGCCACTCTAGTGCGGGCCCTA GTAGGAGACACACTAGCTCAGATGGTTGGTAGCATTGCCACTGCAGCTGCAGGTTTGTTC ATTGGTTTTACTGCATGTTGGCAGCTGGCATTCATTTTACTCGCATTGATTCCTCTGATC GGAATTAACGGATATGTTCAAGCAAAGTTCATGAAAGGATTCAGTGCAGATGCAAAGATG ATGTATGAGGAAGCAAGCCAAGTTGCAAATGATGCAGTTGGGAGCATAAGAACAGTTGCT TCTTTCTGTGCTGAAGAAAAGGTAATGGACCTATACAGAAGGAAATGTGAAGGCCCTACG GAGGCAGCGAAAAGACAAGGCTTGATCAGCGGAATAGGATTTGGAATATCTTTCTTCTCT CTGTTTTGTGTCTATGCAACCTGTTTCTATGCGGGAGCTAAACTTGTTGAGGCTGGAAAA ACAACATTTCCACACGTTTTCCAAGTTTTCTATGCTTTAACCATGGCAGCCATGGGAATT TCTCAGTCGAGCTCCTTTGCTGTTGATTCTAGTAAAGCCAAGAATGCTGCTGCTTCCATA TTTGCAATGATAGACAGGAAGTCAAAGATAGACTCTAGTGACGAGTCTGGTGTGAAATTG GACAGCGTAAAGGGAGAGATTGAGCTTCACCATGTAATCTTTAAATATCCATCTAGGCCA GACATACAGATTTTCCGAGACTTAAGTTTGACTATTCACTGTGGCAATACAGTTGCCTTG GTTGGAGAAAGTGGGAGCGGAAAATCCTCAGTAATAGCATTGTTGCAAAGATTTTATGAT CCGGATTCAGGTCATATCACACTTGATGGAATTGAACTTGGAAAATTCCAATTGAAATGG TTAAGGCAACAGATGGGGCTTGTGAGCCAAGAACCTGCTTTATTTAACAACACCATCCGC GCCAACATTGCATATGGAAAAGAAGGAGATGCAACTGAGGCTGAAATTATAGCTGCATCA GAGTTGGCCAATGCCTACAGGTTCATTAGTAGCTTAGGACAGGGGTTTGACACCGTAGTA GGAGAACGAGGAGTGCAATTGTCCGGGGGACAGAAGCAACGCATAGCCATTGCGCGTGCT ATAATCAAGAGCCCCAAGATATTACTGTTAGATGAAGCTACAAGTGCACTCGATGCTGAA TCTGAGAGAGTGGTTCAAGATGCATTAGATGGAGTGATGGTAAACCGGACCACAGTGGTG GTTGCCCATAGACTATCCACAATCAAGAATGCTGATGTGATCGCAGTGGTAAAAAATGGG GTTATCGTAGAGAGAGGCAAGCATGATACTTTGATGAATATCTCGGATGGATCTTATGCA TCCTTAGTAGCTCTTCACATGAGTGCTTCAACTGCATGA
PEP MTNRDHDKSSNGGDEKTEKVAFIKLFSFADKTDIMLMLVGTIGAMGNGSWERQAARIRAL YLKTILRQDVAFFDMETNSGEVIGRMASDTVLIQNAMGEKVGKFVQLFSTFIAGFIIAFI KVRLLTLVMLSCVPVLVAAGASISFIVTKMGSRGQSAYAKAANVLDQTIGSIRTVASFTG EKKAITSYNKNLVDAYKSGVHEGSAAGIGYGLVMLVLFFSYALAVWFGSRMIREKGYSGG DVLNVILAVLTASMSLGQASTCLSAFAAGQVAAFKMFETISRRPEIDAYDKKGKTLNDIR GDIELREVFFSYPARPDEQIFNGFSLYIPSGTTAALVGESGSGKSTVISLIERFYDPRAG EVLIDGINLKEFQLKWIRSKIGLVSQEPVLFASNIKENIAYGKDGATLEEIKAAAQLANA AKFIDKLPQGFDTMVGEHGTQLSGGQKQRIAIARAVLKDPRILLLDEATSALDAESERIV QEALDRIMVNRTSVIVAHRLSTVRNADTIAIIHKGKMVERGSHSDLLKDPEGAYSHLIRL QEVNKGSEQTAEAQNKSEITTKCFRQLSQRMVLVRSLSRNSSVGSMRENNTLQADPEAPV LPLEQPPKISLRRLAVLNKPEIPVLLIGTVAAIISGVMIPIFGLLLSKVVKTFYEPPLQQ KKDSEFWAIMFMTLGVASLLVIPAREYFFSVAGSKLIERIRLICFERVVHMEVGWFDEAE NSSGAIGARLSADATLVRALVGDTLAQMVGSIATAAAGLFIGFTACWQLAFILLALIPLI GINGYVQAKFMKGFSADAKMMYEEASQVANDAVGSIRTVASFCAEEKVMDLYRRKCEGPT EAAKRQGLISGIGFGISFFSLFCVYATCFYAGAKLVEAGKTTFPHVFQVFYALTMAAMGI SQSSSFAVDSSKAKNAAASIFAMIDRKSKIDSSDESGVKLDSVKGEIELHHVIFKYPSRP DIQIFRDLSLTIHCGNTVALVGESGSGKSSVIALLQRFYDPDSGHITLDGIELGKFQLKW LRQQMGLVSQEPALFNNTIRANIAYGKEGDATEAEIIAASELANAYRFISSLGQGFDTVV GERGVQLSGGQKQRIAIARAIIKSPKILLLDEATSALDAESERVVQDALDGVMVNRTTVV VAHRLSTIKNADVIAVVKNGVIVERGKHDTLMNISDGSYASLVALHMSASTA


| Top |