Cherry SNP DataBase

Gene information

Gene Pav_sc0001623.1_g030.1.mk
Chromosome name PAV_r1.0chr1
start 34515847
end 34517764
PAV_r1.0 name Pav_sc0001623.1
start 4746
end 6663
direction -
Annotation NR PREDICTED: zeaxanthin epoxidase, chloroplastic
Sequence CDS ATGGAGAGAGACACACTTCCAACTTTCTTCAATTCACCCAAAAAAAAACAGATAAGAGAG AGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAACACTGTGGCCTCTCTC TCGAGAGAGAAGAGAGAGATGACTGATCAGAAGAAAAAGCCCAAGGCAGTGATAGTGGGA GGGAGCATAGCAGGGGTATCATGCGCACACACGCTCATATTAGCTGGGTGGGATGTTGTG GTGGTAGAGAAATCATATGCAGCCCCAACTGGAAGCCCAACTGGGGCAGGACTTGGCCTT GACCCTCTGGCTCTAAAACTCATTCAGTCATGGATCAAAGAGCCTGAGCTTCTCAACAAG GCCACTCTATCCCTCACAATTGATCAGAATGATGCAATAGATGGTGAGAAAAAGGTAAAA TGGACATTAACTAGAGATGAGGACTTCAACTGTAGAGCAGCACATTGGGCTGACCTACAT GCCCTTCTGTACAAAGCTCTACCACCAAACTTGTTTCTCTGGGGTCACCATTTCCTATCT TTCTCCGTTTCTAGTGACAAGGGTTCAGTTAAAGTGAAGGCCGCAGCTCATCAAATGAAT GAGATCATCGAAATCGTTGGCGATTTGCTTGTTGCTGCAGATGGGTGCCTCTCCTCTATC CGCCAAAGTTTTGTCCCTGACCATAAACTGAGGTATTCAGGTTATTCTGCATGGAGAGGC GTTCTTGATTTTTCAGGAAATGAGAATTCAGAAACCATAATTGGCATCCGGAAGGCATAC CCTGAACTTGGGAAGTGCTTGTACTTTGGGTTAGGTTCTGGAAGTCACACTGTGCTATAT GAGCTTTTGAACCAGAGGCTCAATTGGATTTGGTATGTCCACCAACCAGAGCCTGATCTG AAGCGTAACTCGATGACCACGAAAGCAAGCAGTGACACGATCCAGAATATGCACAAAGAA GCAGAGAAGGTGTGGCTTCCAGAGTTTGTGAGAGTGATCAAAGAAACTAGGGAGCCTTTC ATCAATGCCATATATGACAGTGAACCTTTGGAACAAATCTACTGGGACAATGTGGTACTA GTTGGAGACGCAGCTCATCCCACAACTCCTCATGCTGTAAGAAGCACGAATATGTCGGTA TTAGATGCTGCAGTGCTAGGCCAATGCCTGAAGAAGTGGGGAGCACAAAATTTGCAATCA GCTCTTGAAGAATATCAGTCAATTCGCCTACCAGTTGTATCCAAACAAGTCTTGCACGCA AGGCGAATGGGTCGGATTAAACAAGGCCTGGTTCTTCCTGATCGACCGTCTTTTGACCCC AAGACTGCTAGTTCAGAGGAATGCCAAGAGCTTCAACAGAGACTCATGCCCTTTTTCAGT GATGTTCCTGCCATACTACTTTGA
PEP MERDTLPTFFNSPKKKQIRERERERERERERERENTVASLSREKREMTDQKKKPKAVIVG GSIAGVSCAHTLILAGWDVVVVEKSYAAPTGSPTGAGLGLDPLALKLIQSWIKEPELLNK ATLSLTIDQNDAIDGEKKVKWTLTRDEDFNCRAAHWADLHALLYKALPPNLFLWGHHFLS FSVSSDKGSVKVKAAAHQMNEIIEIVGDLLVAADGCLSSIRQSFVPDHKLRYSGYSAWRG VLDFSGNENSETIIGIRKAYPELGKCLYFGLGSGSHTVLYELLNQRLNWIWYVHQPEPDL KRNSMTTKASSDTIQNMHKEAEKVWLPEFVRVIKETREPFINAIYDSEPLEQIYWDNVVL VGDAAHPTTPHAVRSTNMSVLDAAVLGQCLKKWGAQNLQSALEEYQSIRLPVVSKQVLHA RRMGRIKQGLVLPDRPSFDPKTASSEECQELQQRLMPFFSDVPAILL


| Top |