Cherry SNP DataBase

Gene information

Gene Pav_sc0001701.1_g150.1.mk
Chromosome name PAV_r1.0chr7
start 976158
end 977372
PAV_r1.0 name Pav_sc0001701.1
start 78162
end 79376
direction -
Annotation NR PREDICTED: uncharacterized protein LOC103339049 isoform X1
Sequence CDS ATGGCGTTTCCAGCTGCTCTCAGTCTCAGTACTGCATCTCTCTCATCAATCTCAAGCCAT CCACACTCTCATCTCCTCCCTTCTCATCAAATTAACTGCAGCTTCTTCTCTCCCTCTCCA TGTATATACAGTAATCATACTAGTCATTCAAAGCCTTACAGAAGACTAACACCCTGCAGC CAGCACTGTTGTTTTCGTGTTTCGTATCGATTCTCTGCTGGTGCCGAAGGCGAGGACGAC GACAACGAAGAAGCCGAGGATGGTAGCTTCGATGAAGCTGTTGTCCTTTTCAACACAAGG GACTACTACAAGTGCCATGACTTCCTTGAGTCACTTTGGAACAATGCTGAGGAACCCACC AGAACTCTTATTCATGGCATTCTACAATGCGCTGTGGGATTCCATCACCTATTCAACCAG AATCATAAAGGAGCCATGATGGAGCTGGGAGAGGGACTTTGTAAGCTGAGAAAGATGAAT TTCAAAAGTGGTCCATTTTATCAGTTTGAGCAAGAAATCTCTGCAGCTCTGGATTTTATT TATCAAACACAGATAGAGTTAGCTGCCTGTACAGAGGATCTCTGTGTTACAATGGATCAA TCAGAGAGATCATACCAACTTCTAGGTGGGTATGCTGCAGGTCAGCTACTATATACCCTG CAAAGTGACCCAAATGAAACCATGTATATTGTGTTCTCCCCTCACAGGTCTTATGACAGT GAGCCACCAAAGGTTAAGCTTCCAACCCTCAATGCAACCGCAGAACATCTCGTGGCCTGT CAATATAAGTGA
PEP MAFPAALSLSTASLSSISSHPHSHLLPSHQINCSFFSPSPCIYSNHTSHSKPYRRLTPCS QHCCFRVSYRFSAGAEGEDDDNEEAEDGSFDEAVVLFNTRDYYKCHDFLESLWNNAEEPT RTLIHGILQCAVGFHHLFNQNHKGAMMELGEGLCKLRKMNFKSGPFYQFEQEISAALDFI YQTQIELAACTEDLCVTMDQSERSYQLLGGYAAGQLLYTLQSDPNETMYIVFSPHRSYDS EPPKVKLPTLNATAEHLVACQYK


| Top |