Cherry SNP DataBase

Gene information

Gene Pav_sc0001710.1_g1360.1.mk
Chromosome name PAV_r1.0chr3
start 4255008
end 4267345
PAV_r1.0 name Pav_sc0001710.1
start 681905
end 694242
direction +
Annotation NR PREDICTED: golgin candidate 5 isoform X1
Sequence CDS ATGGCGTGGTTCAGTGGGAAAGTCTCTTTGGGGAACTTCCCCGATCTCGCCGGGGCCGTG AATAAGCTCCAGGAGAGCGTCAAGAACATCGAGAAGAATTTCGATAGCGCCCTTGGGTTC GAAGAAAAAGAGAAGGCCGAATCCGGTAATGAAGCTTCAGGATTATGGCCTTCATCTACT GAAAGGAAATTGCTATTTGATCCTACGGCTGATAAGGAGGAAACTGAAGTTGTCAAGGAA GAAACAGATGATAAGCATGCTGCAACGGTGGAGGAAACAAAGACTGTGGTAGCAGAGCCT GAAAAATCTGAATCTGAATCATCTTCACTGCCAGTTGAGCCCTTTGAACCCACTGTTAAG AATGATGGCCCATCAGAATCTGTGGGTTCACAAGATGACAACAAGATTTCAGTAGTGGGA CCCTCAGTAAATCCAGAAACATTGCAGGGTGAGTCAGGAGCTGTTGAAGTAGATCAAGTT GAGGAGGGTCATACTGTTCTTCCGCGTGAGGCACATGATGTTGATGTGCATGAGACTGTG GATGAACAAAAGACACAAGTAGAGCAGAATGATGGACATATGACTCAGGCTGGAGAGATT GTTGAAACAGTTGCTATGGTTGAAGGTGAGACTCCAACTGATAGCCAGCCTGGAGGTTTG ACTGAGCCCTCCAGTTTACACTCTGTTACCACTGGGGAAATTCATAGTGGTAGATCTTCT ACCAATCAACCACCAGGTGTAAATCCTTCTGATGATGCTTCGGATGCGGTTTCTGAATCG GTTTCTAAAGAACATAATGCCATTGTTGAGGAACCTGAAGTTGAGCAACAAGCTGATGAT AATGAAGCTGATGTTAAACAGCAACATCTGAGCTCAGGGGAAAATGCGTCTGACTCTTCA GATGTTATGATTGAATTGGAGAAGGTGAAGATGGAGATGAAGATGATGGAAGCTGCATTG CAAGGTGCTGCAAGACAGGCCCAGGCAAAAGCTGATGAGATTGCAAAGTTTATGAACGAA AATGAGCAATTAAAATCTGCGATCGAGGATTTGAAGAGAAAATCCAATGATGCAGAAGTC GAGTCGCTGCGAGAGGAATACCATCAAAGGGTTGCAACACTTGAAAGGAAGGTGTATGCT CTTACTAAGGAAAGGGACACGCTTCGGCGGGAGCAGAATAAGAAAAGTGATGCAGCTGCT CTTCTGAAGGAAAAGGATGAAATAATTAATCAAGTTATGGCTGAAGGTGAAGAACTTTCA AAAAAGCAGGCTGCTCAAGAAGGGCAGATTAGGAAATTAAGGGCTCAGATCAGAGAGTTT GAAGAAGAGAAGAAAGGGTTGATTACTAAACTTCAGGTAGAAGAAAATAAAGTGGAGAGT ATCAAGAGGGACAAGACGGCTACAGAAAAATTGCTGCAGGAAACTATAGAAAAGCACCAA ACAGAACTCGCAGCACAGAAAGAGTATTATACTAATGCTTTGGCTGTTGCCAAGGAGGCA GAAGCGATGGCAGAGGCACGTGCCAACAGTGAAGCCAGATCTGAGCTTGAGAGTCGTCTA AGAGAGTCTGAGGAACGGGAAGCTATGCTAGTTCAGGCACTTGAAGAATTACGACAAACG CTGACTAGAACGGAGCAGCAGGCAGTATTTAGGGAAGACATGCTTCGCCGGGACATTGAG GATCTTCAGAGACGTTATCAAGCAAGTGAGCGGCGATGTGAGGAATTGATTACGCAAGTA CCAGAATCTACCAGGCCTCTTCTTAGGCAGATTGAAGCTATGCAGGAAACAACTTCAAGA AGGGCAGAAGCTTGGGCAGCTGTTGAGAGGTCTCTTAACTCTCGGCTCCAGGAAGCAGAG GCCAAAGCTGCGGCTGCTGAGGAAGGAGAGCGATCTGTGAATGAACGCTTGTCTCAAACC TTATCTCGAATTAATGTTCTTGAGGCTCAGATTTCATGTCTTAGAGCTGAACAATCCCAG TTAAGTAAGTCTCTAGAAAAGGAGAGACAAAGAGCAGCTGAAAATAGGCAGGAGTACCTT GCAGCAAAGGAGGAAGCTGATACTCAAGAAGGCCGTGCAAACCAGCTTGAAGAAGAAATT AGGGAACTCAGGCGAAAGCATAAGCAAGAGTTACAAGATGCATTGATGCATAGGGAACTG CTACAGCAGGAGGTAGAAAAGGAGAAAGCTGCTAGGTTGGATTTGGAAAGGACATCTCGT GTGCGTTCTACTACTGTATCTGATCAAAGTGCTATAACAAGGCACAGTTCGGCTTTAGAG AATGGAAGCTTGAGCCGAAAACTTTCAAGTGCTAGCAGCCTGGGGAGCATGGAGGAAAGC TATTTTCTGCAAGCATCTTTGGACTCATCCGATAGTTTCTCTGAGAGGAGAAATGCTGGG GAGGCAACCATGAGCCCTTACTATATGAAGAGCATGACACCTAGTGCTTTTGAAGCTTCC CTTCGTCAGAAGGAGGGTGAACTTGCATCTTACATGTCTCGTTTGCTGGAGGAACTTCGC GCGGATATTGTAGACTTGAAGGAGATGTACAGAGAGCAAGTAAACTTGCTTGTCAACAAG TCGGCTGCAGAACATTATCTGTCAGACTTTAGACAAGGTTTCTACAATTTTGCTATGCGG GGTCGTCATCTCGATGCCTACTCGGCATACAAGCGTGTGGCGTCGAAGGACCATATCAAT GCTTATGATAGAGAAGAAAGTTCAGGTCTAGTGAATGCAAAAGGTATTGGAAACCCTTCA TGGAGACACTCTTTGCCGCATATGCTTGTGGCAACTCTTTCTTCATTCTTATTTGGCTAC CATCTCGGAGTGGTTAATGAGACACTAGATAGCATTTCTATGGACCTTGGTTTCAGTGGG AATCCCTTGGCTAAGGGTAATTAG
PEP MAWFSGKVSLGNFPDLAGAVNKLQESVKNIEKNFDSALGFEEKEKAESGNEASGLWPSST ERKLLFDPTADKEETEVVKEETDDKHAATVEETKTVVAEPEKSESESSSLPVEPFEPTVK NDGPSESVGSQDDNKISVVGPSVNPETLQGESGAVEVDQVEEGHTVLPREAHDVDVHETV DEQKTQVEQNDGHMTQAGEIVETVAMVEGETPTDSQPGGLTEPSSLHSVTTGEIHSGRSS TNQPPGVNPSDDASDAVSESVSKEHNAIVEEPEVEQQADDNEADVKQQHLSSGENASDSS DVMIELEKVKMEMKMMEAALQGAARQAQAKADEIAKFMNENEQLKSAIEDLKRKSNDAEV ESLREEYHQRVATLERKVYALTKERDTLRREQNKKSDAAALLKEKDEIINQVMAEGEELS KKQAAQEGQIRKLRAQIREFEEEKKGLITKLQVEENKVESIKRDKTATEKLLQETIEKHQ TELAAQKEYYTNALAVAKEAEAMAEARANSEARSELESRLRESEEREAMLVQALEELRQT LTRTEQQAVFREDMLRRDIEDLQRRYQASERRCEELITQVPESTRPLLRQIEAMQETTSR RAEAWAAVERSLNSRLQEAEAKAAAAEEGERSVNERLSQTLSRINVLEAQISCLRAEQSQ LSKSLEKERQRAAENRQEYLAAKEEADTQEGRANQLEEEIRELRRKHKQELQDALMHREL LQQEVEKEKAARLDLERTSRVRSTTVSDQSAITRHSSALENGSLSRKLSSASSLGSMEES YFLQASLDSSDSFSERRNAGEATMSPYYMKSMTPSAFEASLRQKEGELASYMSRLLEELR ADIVDLKEMYREQVNLLVNKSAAEHYLSDFRQGFYNFAMRGRHLDAYSAYKRVASKDHIN AYDREESSGLVNAKGIGNPSWRHSLPHMLVATLSSFLFGYHLGVVNETLDSISMDLGFSG NPLAKGN


| Top |