Cherry SNP DataBase

Gene information

Gene Pav_sc0001710.1_g200.1.mk
Chromosome name PAV_r1.0chr3
start 4840962
end 4854607
PAV_r1.0 name Pav_sc0001710.1
start 94643
end 108288
direction -
Annotation NR PREDICTED: coatomer subunit beta'-2 isoform X1
Sequence CDS ATGCCTCTCAGACTGGAAATCAAGAGAAAACTTGCTCAAAGATCAGAGAGAGTAAAATCT GTGGATCTACATCCAACAGAGCCATGGATTTTGGCGAGTTTATATTCAGGAACTGTGTGT ATTTGGAACTACCAGACACAGACCATGGCTAAGTCTTTTGAGGTCACAGAGTTACCAGTT AGGTCAGCCAAATTTATCTCACGCAAGCAATGGGTTGTTGCTGGAGCTGATGACATGTTC ATTCGTGTATACAATTACAATACAATGGATAAAGTTAAAGTATTTGAGGCACATACAGAC TACATTAGGTGTGTTGCTGTCCATCCAACACTCCCATATGTGCTATCATCATCTGATGAT ATGCTTATCAAGCTCTGGGATTGGGACAAGGGTTGGGTTTGCACGCAGATATTTGAAGGA CATTCCCATTATGTCATGCAAGTGACATTTAATCCAAAAGATACCAACACATTCGCAAGT GCATCTCTTGATCGCACCATAAAGATTTGGAATCTAGGTTCCCCAGACCCAAATTTTACA TTGGATGCCCATCAGAAAGGAGTAAATTGTGTTGATTACTTTACGGGTGGTGATAAGCCT TATCTAATTACTGGTTCTGATGATCACACTGCTAAGGTGTGGGACTATCAAACCAAAAGT TGTGTCCAGACACTTGACGGCCATACACACAATGTTTCTGCTGTATGTTTTCATCCTGAA CTTCCTATAATAATAACAGGGTCTGAGGATGGAACAGTTCGAATATGGCATTCAACTACT TACAGGCTTGAGAACACATTGAATTATGGGCTTGAAAGAGTTTGGGCTATTGGATACATG AAGAGTTCAAGGCGGGTTGTAATTGGTTATGATGAAGGAACCATTATGGTAAAACTTGGG CGTGAAGTACCTGTTGCAAGTATGGACAATAGTGGAAAGATCATTTGGGCTAAGCATAAT GAAATTCAAACTGTGAACATTAAGAGCGTGGGAGCTGATTTTGAGGTTACTGATGGAGAG AGATTGCCTTTGGCTGTTAAGGAGTTGGGTACATGTGATCTTTACCCTCAGAGCTTAAAG CATAATCCCAATGGGAGGTTTGTTGTTGTTTGTGGAGATGGAGAGTACATTATATATACT GCTTTGGCCTGGAGAAATCGGTCATTTGGTTCTGCTTTGGAATTTGCTTGGTCATCTGAT GGAGAATATGCTGTTAGAGAGAGCACATCTAAGATTAAGATTTTCACCAAAAACTTCCAG GAGAAGAGGAGTATTCGACCTACATTTTCGGCTGAACATATTTATGGGGGAACTTTATTG GCGATGTGCTCAAATGATTTCATATGCTTTTATGATTGGGCTGAATGCAGGTTGATTCGG CGAATTGATGTAAATGTGAAAAATCTCTATTGGGCTGATAGTGGTGATTTAGTGGCTATT GCCAGTGACACATCGTTCTATATTCTGAAGTACAATCGGGACATAGTCTCTTCTTATTTA GATAGTGGAAGACCTGTAGATGAACAAGGTGTTGAAGATGCATTTGAGCTTCTCCATGAA ATGAATGAACGTGTCAGGACTGGTTTATGGGTTGGGGATTGTTTCATTTATAACAACTCC GCCTGGAGGCTTAATTACTGTGTTGGTGGCGAGGTAACCACAATGTTCCATTTAGACCGA CCAATGTACTTGTTGGGTTATCTTGCCAATCAAAGTCGGGTGTATCTGATAGACAAAGAG TTCAATGTAATAGGGTACACACTACTTCTGGGTTTGATAGAATATAAGACTCTTGTGATG CGTGGAGACCTTGAAAGGGCGAATGAAGTTTTACCTTCAATTCCTAAAGAGCATCATAAC AGCGTGGCTCGTTTCTTGGAATCACGGGGTATGATAGAGGAAGCACTTGACGTGGCCACA GATCCTGATTACAGATTTGAGCTAGCCATACAGCTTGGTAGATTAGAAATTGCAAAGGAA ATTGCCACAGAGGTGCAAAGTGAGTCTAAATGGAAGCAGTTAGGTGAATTAGCAATGTCT ACTGGAAAGTTAGACATGGCTGAGGAATGTTTAAAGCATGCCATGGACCTGAGTGGTTTA TTACTGCTCTATTCTTCTCTTGGGGATGCTGAAGGAATAGCAAAACTCGCAACCCTTGCT AAAGAACAAGGGAAGAACAATGTTGCATTCCTTTGTTTGTTCATGTTGGGTCGATTGGAA GAGTGCCTTGAGTTACTGGTTGAAAGCAACCGGATACCTGAAGCTGCTTTGATGGCTCGA TCTTATCTTCCAGGCAAGGTCTCAGAGATAGTAGCTATTTGGAGAAAAGACCTGAGCAAG GTGGCAATTCTACTTTTCAAAGTTAAAGAAAAGGGTGTTTATCCTCCTGCAGAGGAGTAT GTAAACCATGTTGATAAAGCACACATCACCCTTGTGGAGGCTTTCCGGAACCTGCAAGTG GATGAGGAGGAACCTCTTGAAAATGGGGAAGCAAATCATGAGGTTTCTGAACAGAACGGT GAACAGAACGGGGAACAAACTGCCGAGGAACAGACTGCTGAGGAACAGTATGGAGAAGAA GGGAGCCAGGAGGAGGCTGTTGTGGTGGATGCTGATTCTACGGATGGTGCTGTACTCATT AATGGTAACGAGGCTGACGAAGAGTGGGGTACGAATAATGAAGGAACCTCGTCAGCCTAA
PEP MPLRLEIKRKLAQRSERVKSVDLHPTEPWILASLYSGTVCIWNYQTQTMAKSFEVTELPV RSAKFISRKQWVVAGADDMFIRVYNYNTMDKVKVFEAHTDYIRCVAVHPTLPYVLSSSDD MLIKLWDWDKGWVCTQIFEGHSHYVMQVTFNPKDTNTFASASLDRTIKIWNLGSPDPNFT LDAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQTKSCVQTLDGHTHNVSAVCFHPE LPIIITGSEDGTVRIWHSTTYRLENTLNYGLERVWAIGYMKSSRRVVIGYDEGTIMVKLG REVPVASMDNSGKIIWAKHNEIQTVNIKSVGADFEVTDGERLPLAVKELGTCDLYPQSLK HNPNGRFVVVCGDGEYIIYTALAWRNRSFGSALEFAWSSDGEYAVRESTSKIKIFTKNFQ EKRSIRPTFSAEHIYGGTLLAMCSNDFICFYDWAECRLIRRIDVNVKNLYWADSGDLVAI ASDTSFYILKYNRDIVSSYLDSGRPVDEQGVEDAFELLHEMNERVRTGLWVGDCFIYNNS AWRLNYCVGGEVTTMFHLDRPMYLLGYLANQSRVYLIDKEFNVIGYTLLLGLIEYKTLVM RGDLERANEVLPSIPKEHHNSVARFLESRGMIEEALDVATDPDYRFELAIQLGRLEIAKE IATEVQSESKWKQLGELAMSTGKLDMAEECLKHAMDLSGLLLLYSSLGDAEGIAKLATLA KEQGKNNVAFLCLFMLGRLEECLELLVESNRIPEAALMARSYLPGKVSEIVAIWRKDLSK VAILLFKVKEKGVYPPAEEYVNHVDKAHITLVEAFRNLQVDEEEPLENGEANHEVSEQNG EQNGEQTAEEQTAEEQYGEEGSQEEAVVVDADSTDGAVLINGNEADEEWGTNNEGTSSA


| Top |