Cherry SNP DataBase

Gene information

Gene Pav_sc0001710.1_g370.1.mk
Chromosome name PAV_r1.0chr3
start 4756228
end 4759406
PAV_r1.0 name Pav_sc0001710.1
start 189844
end 193022
direction -
Annotation NR PREDICTED: pentatricopeptide repeat-containing protein At3g16010 isoform X2
Sequence CDS ATGTGCAAATCCCCGTTACTTATGGCAAAAATGGTTGCCAAATCGTTTGCTTTAAAGCGA TCAATATCAACCTATCCTCATCTCTCTGAGAGACTTAATCAAACAGCAGAAAATGAGATA GTTAAAATGTTCCGGTTGCACCGTGCTTCTGGAGAAGTGCAAAACTTTCCCATGAGTAGG AATATGTCAAGGAAGGACCCTTCAGTTAGGATGTTGGATGAGAGGTTCACAAAGATTTTG AAAATTTTCAAATGGGGACCTGATGCAGAAAAGGCCCTGGAAGTGCTGAAGTTGAGAGTG GATCATCGATTGGTTCTCGCGGTTCTCAAGATTGATGTTGAAGTCAATGTTAAGATTCAG TTTTTCAAGTGGGCTGGGAAGAGAAGGAATTTCGAACACGATTCAACCACATACATGGCG CTGATCCGTTGCTTGGATGAGGCTGGTGGTGTTGGTGAAATGTGGAAAACCATCCAAGAA ATGGTTCGGAGTACATGTGTTATTGAGCCAGCTGAATTATCTGAAATCATAAGAATCTTA GGCAGGGCTAAGATGGTAAACAAGGCACTATCTGTCTTCTACCAGATCAAAGGCCACAAG TGCAAACCAACGGCAAACACTTACAACTCCATGATCTTAATGCTGATGCAAGAAGGTCAT CATGACAAGGTCCATGAGCTCTATAATGAGATGTGCAACGAGGTTAACTGTCTCCCAGAC ACGGTTACATACAGTGCACTAATATCGGCATTTGGGAAATTGGGTCGTGATGATTCTGCC ATTAGGTTGTTTGATGAAATGAAGGATAATGGTTTGCATCCAACTGCAAAGATTTATACT ACCCTGTTGACAATCTTTTTCAAGTTGGGAAAGGTTGAGAAAGCTTTAAGCCTGGCCCAG GAGATGGGAGAGAAGGGGTGTCCGCCTACTGTGTTTACCTACACTGAATTGATAAAGGGG CTTGGCAAAGCTGGTAGGGTTGAAGATGCTTGTGTTATATACAAAAACCTTCTGAGGGAG GGTTGTAAGCCTGATGTCGTGCTCATTAACAATTTGATAAACATTTTGGGAAAGGAAGGT CGTATAGAAGATGCTATTAAGCTTTTCAACGAGATGGTTTCTTTGCGTTGCACACCTAAT GTGGTGACATACAACACTATAATTAAAGCTTTATTTGAATCCAAAGCTCCAGCTTCTGAA GCTGCGTCATGGTTTGAGAAGATGAAAGTTAATGGCATTGTTCCCAGCTCATTTACCTAT TCAATTCTTATTGATGGTTTTTGCAAAACAAATAGAGTTGAGAAAGCTCTGTTGCTTCTT GAGGAGATGGATGAAAAGGGGTTTCCTCCTTGTCCAGCTGCGTATTGCAGCCTGATCAAC AGTCTTGGAAAAGCAAAGCGGTATGAAGCTGCAAATGAGTTATTTCAAGAATTGAAAGAG AACTGTGGGCGTTCAAGTGCTAGGGTATATGCTGTGATGATTAAACATTTTGGGAAATGC GGGCGTCTCGATGAAGCTTTGGATCTTTTTAATGAGATGAAGAAACTCGGATGCACTCCA GATGTGTATGCTTATAATGCGCTCATGTCAGGGATGGTGAGGGCTGGCATGATAGATGAA GCACATTCCTTGCTTAAAGTAATGGAAGAAAATGGTTGCATTCCAGACCTAAACTCGCAA AATATCATTTTAAATGGCTTGGCCAGGACAGGGGGACCAAGTCGGGCTTCGGAAATGTTT TCCAAGATGAAGCATTCTAAGATTCAACCAGATGCAGTTTCTTATAACACTGTTCTTGGT TGTCTCAGCCGAGCTGGTATGCTTGAGGAGGCTGCAAAGCTGATGAAAGAAATGGATTCA AAAGGTTTTCAATATGATCTCATCACTTACTCATCAATACTTGAGGCGGTTGGCAAGGTT GATGATGTTCGCAAGACTTCCTCAGAGGGATATGGTTATACGCCCTATTAA
PEP MCKSPLLMAKMVAKSFALKRSISTYPHLSERLNQTAENEIVKMFRLHRASGEVQNFPMSR NMSRKDPSVRMLDERFTKILKIFKWGPDAEKALEVLKLRVDHRLVLAVLKIDVEVNVKIQ FFKWAGKRRNFEHDSTTYMALIRCLDEAGGVGEMWKTIQEMVRSTCVIEPAELSEIIRIL GRAKMVNKALSVFYQIKGHKCKPTANTYNSMILMLMQEGHHDKVHELYNEMCNEVNCLPD TVTYSALISAFGKLGRDDSAIRLFDEMKDNGLHPTAKIYTTLLTIFFKLGKVEKALSLAQ EMGEKGCPPTVFTYTELIKGLGKAGRVEDACVIYKNLLREGCKPDVVLINNLINILGKEG RIEDAIKLFNEMVSLRCTPNVVTYNTIIKALFESKAPASEAASWFEKMKVNGIVPSSFTY SILIDGFCKTNRVEKALLLLEEMDEKGFPPCPAAYCSLINSLGKAKRYEAANELFQELKE NCGRSSARVYAVMIKHFGKCGRLDEALDLFNEMKKLGCTPDVYAYNALMSGMVRAGMIDE AHSLLKVMEENGCIPDLNSQNIILNGLARTGGPSRASEMFSKMKHSKIQPDAVSYNTVLG CLSRAGMLEEAAKLMKEMDSKGFQYDLITYSSILEAVGKVDDVRKTSSEGYGYTPY


| Top |