Cherry SNP DataBase

Gene information

Gene Pav_sc0001710.1_g400.1.mk
Chromosome name PAV_r1.0chr3
start 4732395
end 4747936
PAV_r1.0 name Pav_sc0001710.1
start 201314
end 216855
direction +
Annotation NR PREDICTED: regulator of telomere elongation helicase 1
Sequence CDS ATGCCGACATACAACATCAGAGGCATCGATGTGGATTTCCCATTCGAAGCCTACGATTCC CAGCTCGTTTACATGGAGAAAGTCATCCAATCTCTCCAAGAAAGAAGTAATGCACTGCTG GAGAGTCCCACTGGAACTGGAAAAACCCTTTGTCTTCTCTGTGCCACATTGGCCTGGAGG AAGAGTTTGGGTGTTTTCTCAACTGGTCCTAATGTCAAGATGAGTCTGATCACAGGAGAA AAATCAGGTGTTCCATTGTCACAGTCCGCGACAAAAGATCTTCCTACCATAATATATGCG TCCCGCACTCACAGCCAGATCCGGCAAGTAATTAAAGAGTTGAAAAGAAGCTCTTACAGG CCGAAAATGGTAGTGTTGGGGTCTCGAGAACAATTATGCATTAATGAGGAAGTGAGTTTA CTACGCGGAAGAACACAGACAAAGGCTTGCCATTTCCTCTGCCGGCGCACTAAGGAAACA AAGGATAAAAAGCGTCATTGTGCTCATTATGCTCGTGGTTCTGGTTACCTAAAGAATAAT CCTCATCTTGGAGATGAACCTATTGATATCGAGGATTTGGTGAATACTGGAAGAAAATTA GGGCCGTGTCCTTATTATTTATCGAGGGAACTCCATAAGGTTGTTGATATATTATTCGCA CCTTATAACTATCTTATTGATCATGGGTATAGAAAATCGCTACAGATAGATTGGAAAAAC AGTATTCTCATATTCGACGAAGCTCATAACCTGGAAAGCATATGCGCAGATGCAGCTTCC TTTGACTTGCCTTCTTGGCTTCTTACAGCTTGCATTTCTGAAGCGAAAAATTGTATTGAC CTTTCTATAAAAAGAAGGGAAGAATCAACTGATAAATCACAGAATCCAGATGACTTTGCA ATTCTCAGAGCGCTTCTTTTGAAGCTTGAGAAGCGTATTTCTGAAGTGCCTATCGAATCC AAGGAATTGGGATACACTAAGCCTGGGCCTTCTATCTATGAACTCCTCGCTGAATTAAAC ATCACACAGGATACTGTCCCTAAGCTCATTAAAATACTTGAGGATGCTACTGTACTTATT GAGGAAGAAAATCAGAACAAGGCAAATCGAAGTGTCTGCCGGCTGGAAAGCATTAGTGAC ATGTTTAATTTAATTTTCAGAGATACAGACAATAACCATGCAAAATCCTATCGTGTTCAT GTACAAGAAGTTGAAGCAGCTGCAATTGATGGTTTAAAGGGTAAGGCATCTAGGACACTC AGCTGGTGGTGTTTTCATCCTGGAATTGCAATGGAAGAATTCGCCAAGATGAATGTGGGC TCTATTATACTGACATCTGGCACATTATCTCCCTTGGATTCATTTGCACAGGAACTGAAA CTAGAGTTCCCTGTGCGGTTGGAAAACCCTCATGTTATTACCCCGAATCAGATATGGGCT GGAGTTGTACCAGCTGGACCTTCTGGTTTCTCTTTCAACTCCTCTTATAGAAATCGCGAT TCTCTGGAGTACAAACGGGACCTTGGAAATGCCATTGTCAATTTTGCTCGAATCGTTCCC GATGGATTGCTTGTATTCTTTCCTTCTTATTACATTTTGGACCAATGCATTGCCTGCTGG AAGAATACGAGCCATGCCAATTCAACTACAATATGGGAAAGAATCTCCAAACATAAGAAA CCTGTTGTAGAACCTAGACAATCTTCATTGTTTCTTTTGTCAATTGAGGACTATATGGCT AAGCTGAAGGACACCTCAGCTTCTGGTGCAGTATTTTTTGCTGTTTGCCGTGGTAAGGTA AGTGAAGGTCTAGATTTTGCTGATCACGCTGGAAGGGCTGTAGTCATTACTGGTCTACCA TTTGCCACAAGGAATGATCCTAAGGTTCGTCTGAAACGTGAATACTTGGATCAGCAGGCA TATTCCCAGAGGCAAGTATGTAAGTTGGAGGTTCTTACTGGAGAAGACTGGTACAATCAA CAAGCATCACGAGCTGTAAATCAGGCTGTTGGACGTGTAATCCGTCATCGTCATGATTAT GGAGCAATTATTTTTTGTGATGAAAGGTTTGCACAACCAAATCGTCAATCTCAAATATCG CTCTGGATACAACCTCATATCAAGTGTTACTCCAAATTTGGGGATGTAATTTTTTCGTTG ACCCGTTTCTTTCGGGATGGAGGAGCTCGGGGTCCTACAAAGCTGAAGTTGTTACAAACT GAAAAATGGGATGCAATTTCTACATCAAATTCAGTACTTGATGAGCAGACAAATGAAACC CCATTCGATCATAAACCATATTCTGTAGGTTCATCAACCTCAGTTCATGGAACATCAGGG AAAATATATGAGTTGAAAACTGAGCAACCGCCAGAAAAACTTTATCTGGATAAATTTCTC CCTCTGACAACAGCAGTCAGTCAAGACTGCCCTGTAAAGTCATCTTCTTCCCTACTTAAA GCTGGCAGGGACAAACTTTCAAGCCTGTTAGGGGAAGTTCTTCCTGCCAATCGCTCATCT CTTACTTCCTGTAAGGATCAGTCTGTGTCTTTGAAGTGTTCAAATAATCTATTCCGAAAT GGGAAAAAGCTGCTTATTTGTGAGAGGGAAACTCTGCAATGTCAAGATAGTAAAGTATTT GGTTTTCCTGGCAAAAATGAGAAACTAGGCGAAGAACTCATAACACCTTGCTCTGCAAAA AGGTGTAAATTAAGCACAGAGCATGACTCAGTACATCTTATTGACAATTCTAATAAGCAT TCATCTCTTGCAAAAGATTCTGATTCATATGGTGGTTTTCCCAATATTAATCTGAGAAGT GAGAGTTCTTCAAGTTCACAAAATGCTCAAGTTGGTTCAGCATTGCTGCGTAAAGACAAG AGGATCATACAACAGGGAGATGCTGAGTTTCTAAGTAACAAAAACAAAAGTGCAATATCC ATCCCTGTGCTCTCTGGTGATAAGGAAACCAGAGGATCTGAGTTTCTAGTTCAGGTTGAA GAAAAACTTAGCACTTTGGAATATAGAGAATTTGTAAATTTGATGAAGGCACTTAAGTCC AAAGCTATGAAGATGAATGAAGTTTTACAATCCATTGCAAGCCTGTTTTCCGGACGAGAG AGGCTTCCTCTTCTTAAAAGATTTAAGGATTTTATCCCAGTAAAGTATCACTCTATGTAT GAGCACTATTTTCAAACAAACGACGGGCTCTAG
PEP MPTYNIRGIDVDFPFEAYDSQLVYMEKVIQSLQERSNALLESPTGTGKTLCLLCATLAWR KSLGVFSTGPNVKMSLITGEKSGVPLSQSATKDLPTIIYASRTHSQIRQVIKELKRSSYR PKMVVLGSREQLCINEEVSLLRGRTQTKACHFLCRRTKETKDKKRHCAHYARGSGYLKNN PHLGDEPIDIEDLVNTGRKLGPCPYYLSRELHKVVDILFAPYNYLIDHGYRKSLQIDWKN SILIFDEAHNLESICADAASFDLPSWLLTACISEAKNCIDLSIKRREESTDKSQNPDDFA ILRALLLKLEKRISEVPIESKELGYTKPGPSIYELLAELNITQDTVPKLIKILEDATVLI EEENQNKANRSVCRLESISDMFNLIFRDTDNNHAKSYRVHVQEVEAAAIDGLKGKASRTL SWWCFHPGIAMEEFAKMNVGSIILTSGTLSPLDSFAQELKLEFPVRLENPHVITPNQIWA GVVPAGPSGFSFNSSYRNRDSLEYKRDLGNAIVNFARIVPDGLLVFFPSYYILDQCIACW KNTSHANSTTIWERISKHKKPVVEPRQSSLFLLSIEDYMAKLKDTSASGAVFFAVCRGKV SEGLDFADHAGRAVVITGLPFATRNDPKVRLKREYLDQQAYSQRQVCKLEVLTGEDWYNQ QASRAVNQAVGRVIRHRHDYGAIIFCDERFAQPNRQSQISLWIQPHIKCYSKFGDVIFSL TRFFRDGGARGPTKLKLLQTEKWDAISTSNSVLDEQTNETPFDHKPYSVGSSTSVHGTSG KIYELKTEQPPEKLYLDKFLPLTTAVSQDCPVKSSSSLLKAGRDKLSSLLGEVLPANRSS LTSCKDQSVSLKCSNNLFRNGKKLLICERETLQCQDSKVFGFPGKNEKLGEELITPCSAK RCKLSTEHDSVHLIDNSNKHSSLAKDSDSYGGFPNINLRSESSSSSQNAQVGSALLRKDK RIIQQGDAEFLSNKNKSAISIPVLSGDKETRGSEFLVQVEEKLSTLEYREFVNLMKALKS KAMKMNEVLQSIASLFSGRERLPLLKRFKDFIPVKYHSMYEHYFQTNDGL


| Top |