Cherry SNP DataBase

Gene information

Gene Pav_sc0001710.1_g740.1.mk
Chromosome name PAV_r1.0chr3
start 4587294
end 4591140
PAV_r1.0 name Pav_sc0001710.1
start 358110
end 361956
direction +
Annotation NR PREDICTED: uncharacterized protein LOC103327947 isoform X1
Sequence CDS ATGGCTACTCGGAGCGGGTCAAATTGGTGGAGTCTGAGGTTGCTTGGAATGGTTTACCTT GTTTTAGCTTTAGTATTTGTTTCAGCACAAGAAATTTTGGAGCAGCAAGCTTCAAGTCAG ACTCTAGGGGAAGAGGTTGAATCTAATTACTTAATCCGAGTGTCCAGATTTCTTTCGCAT CGGGGTGGAGTGGTTTATAAGCATGTCTGGCCTGAAATGAGTTTTGGCTGGAAAATTGTC GTTGGAACGATAATTGGATTCCTGGGGGCAGCATTTGGGAGTGTAGGAGGTGTTGGTGGG GGTGGCTTTTTTGTTCCAATGCTCACCTTGATTATTGGCTTTGATCAGAAATCATCAACA GCATTATCAAAATGTATGATCACAGGTGGAGCAGCTGCAACTGTCTTCTACAATTTAAGG CTCCGGCATCCGACACTCGAGTTGCCCCTCATTGACTATGATCTTGCACTTCTGTTCCAA CCAATAGGCATTGAGACGTGGAAGAAAGAAACCATCACGAAAAAGAATTTGCTGGATGCT TCCAAAAGTTTGCAATCAAAAGGTGATGGCAGTGAAGACATAACTATCCCGGGAGGGGTA GGCAACGACACAACTGAAACCAAGGAAACTAAAAGAAAGAAGGTTTCTATTCTTCACAAT GTTCGCTGGAGGCAACTTGGGGTCATAGTTATTGTCTGGATCATAATACTTGCACTGCAG ATTGCTAAGAATTACGCGACGAAATGTTCAGTGGTATATTGGATATTAAATCTCTTACAG ATTCCGGTGACCGTTGGGATAACTTCATATGAGGCAGTTTCAAGTGCCACAGCCACATTT ATCATGACATTCTCTTCCTCCATGTCTGTGGTAGAATACTACCTCCTAAAACGGTTTCCA ATTCCATATGCTCTCTACTTTGCTGCTGTTGCTACCGTTTCCGCGATCGTCGGGCAACAT TTAGTAGGAAAGGTGATCAAAGCATTAGGAAGAGCATCCTTGATCATCTTCATTCTTGCT TTCACAATATTTGTGAGTGCATTGACATTAGGTGGGGTTGGCATAGCAAACATGGTGAAA AAGATTGAGCGCAAGGAATCTCTGTGGTTTGAGAGAATGTGCACTCACAAATCTTAG
PEP MATRSGSNWWSLRLLGMVYLVLALVFVSAQEILEQQASSQTLGEEVESNYLIRVSRFLSH RGGVVYKHVWPEMSFGWKIVVGTIIGFLGAAFGSVGGVGGGGFFVPMLTLIIGFDQKSST ALSKCMITGGAAATVFYNLRLRHPTLELPLIDYDLALLFQPIGIETWKKETITKKNLLDA SKSLQSKGDGSEDITIPGGVGNDTTETKETKRKKVSILHNVRWRQLGVIVIVWIIILALQ IAKNYATKCSVVYWILNLLQIPVTVGITSYEAVSSATATFIMTFSSSMSVVEYYLLKRFP IPYALYFAAVATVSAIVGQHLVGKVIKALGRASLIIFILAFTIFVSALTLGGVGIANMVK KIERKESLWFERMCTHKS


| Top |