Cherry SNP DataBase

Gene information

Gene Pav_sc0001749.1_g050.1.mk
Chromosome name PAV_r1.0chr5
start 9730238
end 9740789
PAV_r1.0 name Pav_sc0001749.1
start 11886
end 22437
direction -
Annotation NR Dynamin-related 5A
Sequence CDS ATGGAGAACCTGATCTCATTGGTGAACAAAATCCAAAGAGCTTGTACAGCTCTAGGTGAC CACGGCGAAGCTAGCGCATTACCGACGCTCTGGGACTCCCTTCCCGCCATCGCCGTCGTC GGTGGCCAGAGTTCAGGGAAATCTTCTGTCTTGGAGAGCATTGTTGGGAAGGACTTCTTA CCACGTGGTTCTGGAATTGTTACCCGGCGTCCACTTGTTTTACAACTTCATAAGATTGAA GAAGGCAGCAGAGAATATGCGGAGTTCCTCCATCTTCCTAGGAAGCGGTTCACCGATTTT GAAGGCAGCAGAGAATATGCGGAGTTCCTCCATCTTCCTAGGAAGCGGTTCACCGATTTT GCTGCTGTGAGAAAGGAGATTTCAGACGAGACAGATCGAGAAACTGGCCGCAGCAAACAA ATTTCTAGTGTTCCAATTCATCTTAGCATATATTCTCCTAATGTTGTCAACTTGACACTT ATTGATCTTCCCGGGCTTACAAAAGTGGCTGTTGTTGTCAACTTGACACTTATTGATCTT CCCGGGCTTACAAAAGTGGCTGTTGAGGGTCAATCGGATACTATTGTGCAAGACATTGAA AATATGGTTCGCTCCTACATTGAGAAGCCCAACTGTATAATTCTAGCAATTTCACCTGCT AATCAAGATCTTGCTACATCTGATGCAATTAGAATCTCTCGTGAAGTGGATCCAACAGGG GAGAGGACACTTGGAGTCTTGACGAAGATTGATCTTATGGACAAGGGTACTGATGCAGTT GAAATATTGGAAGGAAAGTCATATCGGCTAAAATTTCCTTGGGTTGGGGTTGTGAATCGT TCACAAGCGGACATTAACAAGAATGTTGACATGATTGCTGCCCGGCGTAGAGAACGCGAG TATTTTTCTACTACCCCAGAATACAAGCACCTTGCTCCAAGAATGGGTTCTGAGCATCTA GCAAAAATGCTTTCTAAGCATTTGGAAACAGTAATTAAGTCGAAAATCCCGGGGATCCAG TCCCTCATTAGCAAGACTGTTGCTGAACTTGAAGCTGAACTGAGTCGCCTTGGAAAGCCC ATTTCTGCTGACGCTGGAGGAAAACTGTATACAATCATGGAGATATGTCGTCTATTCGAT GGAACATATAAAGAACATCTTGATGGCGTGCGCCCGGGCGGTGATAAGATTTACAATGTT TTTGATAACCAGCTTCCTGCTGCTCTAAAAAGATTGCAATTTGACAAGCAACTTTCAATG GAAAATATAAGGAAGCTCATTACTGAAGCTGATGGATATCAACCTCATCTAATAGCTCCT GAACAAGGATACCGTCGTCTCATTGAATCCTCTGTAATTACTATTAGAGGTCCTGCTGAG GCAGCTGTTGATGCGGTTCATGCCATTTTGAAGGATCTGGTTCACAAGTCTGTCAATGAG ACTCCAGAGCTAAAGCAGTATCCTGCTCTTAGAGTAGAGGTTACAAATGCAGCTAGTGAT TCACTTGAGAGAATGAGAGAAGAAAGTAAGAAGGCAACACTAAAGCTAGTTGATATGGAG TGTAGTTATCTGACAGTTGATTTCTTCCGTAAACTTCCTCAAGATGTTGAGAAGGGTGGC AACCCATCACATTCGATTTTCGATAGAGACAATGATTCATATCTCAGGCGAATTGGGACA ACGGTTCTGGCTTACGTCAATATGGTATGTGCAAGTTTGCGTAACTCCATCCCCAAATCT ATTGTCTATTGTCAAGTCCGAGAGGCAAAACGAAGCTTTCTTGACCATTTCTACACTGAC TTGGGAAAATTGGAGACAAAGCAGTTGTCCTCATTACTGAACGAGGATCCGGCAATAATG GAGAGGCGTTCTGCCCTGGCGAAGAGGCTGGAGTTATACAGAAGTGCTCAAGCAGAAATT GATTCAGTTGCTTGGGCTAAGCAGAATACTCAACATCAAAGGTCTGTTGCTGCATGTTTG GTTCAGGGTGTCTATGTTGTTGAGCGGGACCGCCAAGAGGAACGTGAAGGGCCCCAAGCC CTTGCTCCTCCTTGGTGGGAGTTCTTCCATTTTAAGTTGCTCCGCAAGCTTGTGGATGAT GTTGGTTTCTCAATCTTTGGTGCCATTTATGAATTCAAACCTCCTCCTTCTCTTTGTAAC TCCCCATTAGAGGGAATACCTCGTTTTGTAATTGCCTTCCGAGGCACCTTGACGAAGAAT GACTCAGTCTCACGAGACCTTCAGTTGGATGTTGAGGTGGTCCGAAATGGACTTCACCGG ACATCTCGCTTTGAGATTGCTATGCAAGCTGTCCGGAATATGGTTGCTTCAGTAGGTGAT TCAAATGTTTGGTTAGCTGGCCATTCCTTAGGGTCAGCCATGGCAATGCTTGCTGGAAAA ACTATGGCTAGCACTGGCATTTTCCTCAAATCTTTTCTCTTCAATCCACCATTTGTGTCT GCCCCGATAGAGAGGATTAAGGACAAGAGAGTGAAACACGGGCTTCGAATCGCAGGCAGT GTGATTACAGCAGGCCTCACTCTTGCTATGAAGGCTAAACAACAACCACAACAGAGAAGT CATTCAGAAGAAAACCCTTTCACTACTCTGTCTGCATGGTTCCCGAGTCTATTTGTCAAT CCAGCTGATGACATCTGCTCCGAATATATTGGGTATTTTGAACATAGGAAGAAGATGGAG GACATTGGAGCAGGAGCCATTGAGAGGTTAGCAACCCAGAATTCTCTTGGGGGTCTACTA ATGCATGCAATGGGAAAGCAGCCAGCGCCGGAGCCTCCATTGCACCTCATTCCTTCTGCA AACCTGACAGTTAATTTGACCCCGTCACGGGATCTCAAAGAAGCCCATGGAATTCACCAA TGGTGGAGAGATGATCTGCAACTCCGAGTAGAGGTTACAAATGCAGCTAGTGATTCACTT GAGAGAATGAGAGAAGAAAGTAAAAAGGCAACACTAAAGCTAGTTGATATGGAGTGTAGT TATCTGACAGTTGATTTCTTCCGTAAACTTCCTCAAGATGTTGAGAAGGGTGGCAACCCA TCACATTCGATTTTCGATAGAGACAATGATTCATATCTCAGGCGAATTGGGACGACGGTT CTGGCTTACGTCAATGTGATATGTGCAAGTCTGCGTAACTCCATCCCCAAGTCTATTGTC TATTGTCAAGTCCGAGAGGCAAAACGAAGCTTTCTTGACCATTTCTACACTGACTTGGGA AAATTGGAGGTTAGTACAAAAATCTTCTCTTTGTAA
PEP MENLISLVNKIQRACTALGDHGEASALPTLWDSLPAIAVVGGQSSGKSSVLESIVGKDFL PRGSGIVTRRPLVLQLHKIEEGSREYAEFLHLPRKRFTDFEGSREYAEFLHLPRKRFTDF AAVRKEISDETDRETGRSKQISSVPIHLSIYSPNVVNLTLIDLPGLTKVAVVVNLTLIDL PGLTKVAVEGQSDTIVQDIENMVRSYIEKPNCIILAISPANQDLATSDAIRISREVDPTG ERTLGVLTKIDLMDKGTDAVEILEGKSYRLKFPWVGVVNRSQADINKNVDMIAARRRERE YFSTTPEYKHLAPRMGSEHLAKMLSKHLETVIKSKIPGIQSLISKTVAELEAELSRLGKP ISADAGGKLYTIMEICRLFDGTYKEHLDGVRPGGDKIYNVFDNQLPAALKRLQFDKQLSM ENIRKLITEADGYQPHLIAPEQGYRRLIESSVITIRGPAEAAVDAVHAILKDLVHKSVNE TPELKQYPALRVEVTNAASDSLERMREESKKATLKLVDMECSYLTVDFFRKLPQDVEKGG NPSHSIFDRDNDSYLRRIGTTVLAYVNMVCASLRNSIPKSIVYCQVREAKRSFLDHFYTD LGKLETKQLSSLLNEDPAIMERRSALAKRLELYRSAQAEIDSVAWAKQNTQHQRSVAACL VQGVYVVERDRQEEREGPQALAPPWWEFFHFKLLRKLVDDVGFSIFGAIYEFKPPPSLCN SPLEGIPRFVIAFRGTLTKNDSVSRDLQLDVEVVRNGLHRTSRFEIAMQAVRNMVASVGD SNVWLAGHSLGSAMAMLAGKTMASTGIFLKSFLFNPPFVSAPIERIKDKRVKHGLRIAGS VITAGLTLAMKAKQQPQQRSHSEENPFTTLSAWFPSLFVNPADDICSEYIGYFEHRKKME DIGAGAIERLATQNSLGGLLMHAMGKQPAPEPPLHLIPSANLTVNLTPSRDLKEAHGIHQ WWRDDLQLRVEVTNAASDSLERMREESKKATLKLVDMECSYLTVDFFRKLPQDVEKGGNP SHSIFDRDNDSYLRRIGTTVLAYVNVICASLRNSIPKSIVYCQVREAKRSFLDHFYTDLG KLEVSTKIFSL


| Top |