Cherry SNP DataBase

Gene information

Gene Pav_sc0001772.1_g010.1.mk
Chromosome name PAV_r1.0chr5
start 1625917
end 1633006
PAV_r1.0 name Pav_sc0001772.1
start 11666
end 18755
direction -
Annotation NR PREDICTED: uncharacterized protein DDB_G0271670 isoform X1
Sequence CDS ATGTCGTCCTCTCAAAAAGAGTCCAAGACTAGACACAAATTTACTTCAACTTTAAACATA AACATAAAACAAGGTGAAGTACTAAGGGCATTGGATTTGGAGGGGTGGGTAGAGCCGGGA AGGAGGGAGATGGGATCGGGTGGGAGCAAAGCGACGGCGTCTTCAACGTCGTCGTTTGGT GGCAATGGTCGGAGGCGTCGATCCAAATCTAAATTCAGCAGAGTGCTCAAGTTGTCTTGT CTGGGAACCACATCTCGATCCCACGATAGCGACAATGACGACCAGGTATGTGATCATCAG AACAAAGAAACTAGAAATAATGCTCCATGCGCAAGTTTGAATGACACAGAGCCAGATCAC GCAAAGGTTGAGTGTTTCAGAAAGGTTAATGTTGAACAACCTGATGAAATTCCATGTATA TCTTCAAATGTTCAGCTCAATGAATGGGGTCAGGCTAGTATCACTGATACTGCCTCCAGA GCTGGTAGCAGCTCTGCTCAAGCTGCTGCTCCATCTTTGAACCCTTCAAGTCGTTTCCTT TCTCGTTTTAGTTTCATTCCAGGTAATGTAAGCTTCAGATTAAGCCGGGCAACCAGTTTA GGGTCATCCAATCCTCTATCTCCGACAAGTATCACAATACCGAACAACGAAGATGAACTT CATCTACATTCAAGACCTGCTAGAAGTTTTGTAAATAGAGATGAAAGCCAAGAAGCCAGT GACCTTCCACAGTCACAGATTAATAGGAGCGCAACACATTATTATGAAGAGACTTCTGAC AATATAGGATTAAATACTCCGGGATGTGGTTTTTCTGACAACTTGCAAGATAACCAGACA AATTCTTCTAGACATGATGTTGGTAGAAATGCTAACGGTGGTGTAAACTTGTGTTCTCCA AGAAATCATAATGAACCAGGGAGCAACAGAACTAGACCTTCCGAAAGACGCCCAGGTGCT CGGGAACCTGTTGAACGGAATGTTCGTTTCAGTAGAACTTTAAGTGTTGGAAGACTTCGT GACAGGGTACTTCGTCGATCATCATTATCTGATTTAACGTTTTCTTCTTTGCAACAAGAA GGAGAAATGAGAGATACAGATCAAGGTGATGATACAAGAACAATGGTACCTGAAGGCAAT GCTGTAAATTTCGAAAATGGGTCTGGTTATCCTCCATCCAATATGTCTAGTTCATTGTTT AGCATCCAAGACTATGAAGTGGAAACATCAAGACCAAGAGAAGCTAGATATCATGATCTA CTTGAACACAGATCAAATTTCCTAGAGCGGAGGAGAAGAATACGATCTCAGGTTCGTGCA CTTCAGAGGTTAGGGAGCCGCTTTGAAAATGTGTCTGGACATGAGAGATCTTGTATCTTA TCTGGTCAACAGCGAACGGGTCGTTGTACATGTCGTACGAGTAACCGAGATGCCCGTTCA AATGATGACAATAGTGCTAGGGCTAGCATATCAAGAATTGTTATGTTAGCTGAGGCTTTG TTTGAGGTTCTGGATGAAATTCACCAGCAATCTGTGGTTCTATCCTCTCGACCTTCTGTA TCGTCAATTGGATCTGTTCCCGCTCCTACTGAAGTTGTGGAATCTTTGCCCGTCAAATTG TTTTCCAAGTTGCAAAAGCATCAGTATGAGGAGGCTGCACAATGCTACATATGCCTTGTG GAGTACGAAGAAGGAGACATAATGCGAGTACTGCCTTGCCATCATGAATTTCATAAAACT TGTATTGACAAGTGGCTCAAGGAGATTCACAGGGTATGCCCACTCTGTCGCAGGGATATC TGTAGATCCGATGTGTTGCCTGCAGAGAACTAA
PEP MSSSQKESKTRHKFTSTLNINIKQGEVLRALDLEGWVEPGRREMGSGGSKATASSTSSFG GNGRRRRSKSKFSRVLKLSCLGTTSRSHDSDNDDQVCDHQNKETRNNAPCASLNDTEPDH AKVECFRKVNVEQPDEIPCISSNVQLNEWGQASITDTASRAGSSSAQAAAPSLNPSSRFL SRFSFIPGNVSFRLSRATSLGSSNPLSPTSITIPNNEDELHLHSRPARSFVNRDESQEAS DLPQSQINRSATHYYEETSDNIGLNTPGCGFSDNLQDNQTNSSRHDVGRNANGGVNLCSP RNHNEPGSNRTRPSERRPGAREPVERNVRFSRTLSVGRLRDRVLRRSSLSDLTFSSLQQE GEMRDTDQGDDTRTMVPEGNAVNFENGSGYPPSNMSSSLFSIQDYEVETSRPREARYHDL LEHRSNFLERRRRIRSQVRALQRLGSRFENVSGHERSCILSGQQRTGRCTCRTSNRDARS NDDNSARASISRIVMLAEALFEVLDEIHQQSVVLSSRPSVSSIGSVPAPTEVVESLPVKL FSKLQKHQYEEAAQCYICLVEYEEGDIMRVLPCHHEFHKTCIDKWLKEIHRVCPLCRRDI CRSDVLPAEN


| Top |