Cherry SNP DataBase

Gene information

Gene Pav_sc0001772.1_g020.1.mk
Chromosome name PAV_r1.0chr5
start 1616524
end 1621447
PAV_r1.0 name Pav_sc0001772.1
start 23225
end 28148
direction -
Annotation NR PREDICTED: uncharacterized protein LOC103336700
Sequence CDS ATGGATTGGGGTTTTGTACATAAAGCTTGGGACAAGTGGGCTTCTCCCAATATCGGCTCT GATAAGCCATTAAAAGCAGCTATATTGATCAACTATGACCCAACTGGTCCATCTCGCTTG TTGTCTACTATCGCAGAAGAAGAAGGGATAAAAGTGAATCCCATCGAATTGAGTCAATTC ATTGATTTCATCAAATGTGACAAGCTCCAGACTGAGAGCTTCATTATTGGACCAAACCAA TATGTAGTCACATCAATTCATGAGAATTGGTTCTGTGCAAGGTGCATGAACACATCAAAA TCTACTGGTGAAGGCGCTATCGTTATGCATACAGCAGCATTTCTCTTGGTTGCATTGTAC GATGGTTCTATTGGCTCAGCATCTCGTGCTATGGTGGCTGTTGATCAGTTTGCGTGGCAA TTAACTCGAAAGAATCTGTAA
PEP MDWGFVHKAWDKWASPNIGSDKPLKAAILINYDPTGPSRLLSTIAEEEGIKVNPIELSQF IDFIKCDKLQTESFIIGPNQYVVTSIHENWFCARCMNTSKSTGEGAIVMHTAAFLLVALY DGSIGSASRAMVAVDQFAWQLTRKNL


| Top |