Cherry SNP DataBase

Gene information

Gene Pav_sc0001774.1_g060.1.mk
Chromosome name PAV_r1.0chr6
start 24415098
end 24419494
PAV_r1.0 name Pav_sc0001774.1
start 38870
end 43266
direction +
Annotation NR PREDICTED: putative metallophosphoesterase At3g03305
Sequence CDS ATGGGGAGTGCCATTCTGATGCTAGAGCTCTTTTTATGCCTCACTGTCTATGCAGCAAGT GAAGAATTCGAATTCTCGTCTTCAAAATCCAGTTCGCACAGGAGAGTGATAGATGTAAAG GGAGGCCCAGAGTCACTAGTGTGGGTGGTTCAGCTTTCTGATCTTCATTTCAGTGTCCAC CATCCTGACAGAGCACTTGACTTCAAGAACTTTGTGGGGCCTGCTCTCTCCATGATCAAC CCTTCTCTGGTCCTCATCACCGGTGATCTCACAGATGGAAAAAGCAAGGATTTGTTGACA ATGAAGCAAAATGAGGAGGAGTGGGTGGAATACCAGAACATGATGGCAGATGTGATAAAA AGGAGTAGACTTGACAGGAGTATCTTCTTTGATCTTAGAGGGAATCACGATAACTTTGGC GTACCGGTGCTTGGTGGTTCCTTTGATTTCTTTTCAAAGTATAGCATCAATGGGCAGTTG GGCAGAACTGGGAATGTCAATAGTGTCACACTTCAGACTGGTGAGCGGAAGCATCTGTTT GTTGGAGTAGATAGCACAATGTCTGTTGGTCTACGAGGTCCCACTAATCTTTTTGGGCAT CCAACTGATCAACTATTAGCAGAACTGGATATGGAGCTCTCACAGTGGGATTCTCAATCA GAAAAACCATTAAGCAAGATTTCCTTTGGGCATTTTCCTCTTTCATTCTCAGCAACCTCA TACTCTGGGAAGAGCCTAAAAGATATCTTCCTCAATCATTCCATATCGGCTTATATATGT GGGCATCTCCATACACGGTTTGGTAAAAACTTGAAGCGGCATCATCAGTTGAGTCGTCAT TTTTTATCGTTGCAGAAATTTTTCCAGCCAAATGTACACCAATTATCTTTTCATGGTACT GCTAATTGTTCAATTGAAGCCCCAGCGGCTAGAGAATTCTGGGAGTGGGAGATGGGTGAC TGGAGGAAGAGCAGAGCCATGAGAATTTTGGCCATTGATAGAGGTCATGTTTCGTATGTT GACATTGACTTCATGTCAGGCACCAAAAAGACTATCATATTGCCAACTTTTCCCCTGGAT TCACGGTTCATGTCAACATCTTCATCCCATCATAAGTATGAATGTCATGCTGTGGTATCT TACGAGACAGTAAGAGCCCTGGTATTTTCTGTTTCTCCAATTGTGTCGGTTATGACTAGG ATCTATGACTCAAGACCTGGATATCTCAATCTGGTATTTGAGGCACCCATGAGAAAGCTC GTGGATAACACCTCCAGGGGAGATCTTTATGTTGCTCCATGGAATTATAGAGCCTTTGAG GATCCAATTCCTAATAGATATTGGCTGCAAATAGAAGCAACTGACTTCATGGGCAGATCG ACTTCAACTGATTTAAGGCCGTTTTCTGTTAATGGTCTTAGTACTATGCTCTCATGGACA TGGAAGGAGTTTATGGTCATGGGTTGTCAATGGGCTGCTTTGTATTACCCAATGTTCTGG TGTGCTGTGTACTTTATACTCTCCATTCTCCTTATTCCAAAAGCTCTCCTCATTTTCTCA ATTAGGCATTTCACTTACAAGAATAAGGGCTTCCTAAATGGCATAGGATTTGTTTTACAG GAGCTTAGCAGGGTTCCCTTCACATGGTTTGGTTTTTTAGGATACTTATTCTACCTTATA TTATTCCCCTGGTTTATTGGGAAAGTTTTCACGGACGACAAGGATAAAGGATACATGACC TATATGGGGTGGGTAGTTAAATCTTTCAATCAAAAGGGAAAACATGAATATGCCGGATCT CCAGATATAATGGTGGTTGTTCTTCCACATCTCTTCTTTGTGGTTTTTCCTGCTATTTTG CTGACTGGGGCTTTGGCTACTGAAAAACAGATCTCCAGGGAAAACTTTCTCTCACTTACG GGGAAGAAAGAAGATGACTATGATCAAGAGGAAAGGAGTTCTTTATGGTATGATTACCAA CGGAGTAGGAAATCAAATTCCTGTGTTGGAAACCGGTGGATTCGAAAATACATATGTGAA TACTCATCCAGACTTCTTAAGATGATGGAGGCAAGAAATTGTTTGGAACCTTGCAACCAC CATTCTGAAACGTTACAAGGTCTCCAAACTAAATTTTCTTTCCTCTGTCATCCTGGGAAC CGTATTGGAGAAATGACTACTAGAATTGCAGGGCTCTCATCAAAGCATATGAGATGA
PEP MGSAILMLELFLCLTVYAASEEFEFSSSKSSSHRRVIDVKGGPESLVWVVQLSDLHFSVH HPDRALDFKNFVGPALSMINPSLVLITGDLTDGKSKDLLTMKQNEEEWVEYQNMMADVIK RSRLDRSIFFDLRGNHDNFGVPVLGGSFDFFSKYSINGQLGRTGNVNSVTLQTGERKHLF VGVDSTMSVGLRGPTNLFGHPTDQLLAELDMELSQWDSQSEKPLSKISFGHFPLSFSATS YSGKSLKDIFLNHSISAYICGHLHTRFGKNLKRHHQLSRHFLSLQKFFQPNVHQLSFHGT ANCSIEAPAAREFWEWEMGDWRKSRAMRILAIDRGHVSYVDIDFMSGTKKTIILPTFPLD SRFMSTSSSHHKYECHAVVSYETVRALVFSVSPIVSVMTRIYDSRPGYLNLVFEAPMRKL VDNTSRGDLYVAPWNYRAFEDPIPNRYWLQIEATDFMGRSTSTDLRPFSVNGLSTMLSWT WKEFMVMGCQWAALYYPMFWCAVYFILSILLIPKALLIFSIRHFTYKNKGFLNGIGFVLQ ELSRVPFTWFGFLGYLFYLILFPWFIGKVFTDDKDKGYMTYMGWVVKSFNQKGKHEYAGS PDIMVVVLPHLFFVVFPAILLTGALATEKQISRENFLSLTGKKEDDYDQEERSSLWYDYQ RSRKSNSCVGNRWIRKYICEYSSRLLKMMEARNCLEPCNHHSETLQGLQTKFSFLCHPGN RIGEMTTRIAGLSSKHMR


| Top |