Cherry SNP DataBase

Gene information

Gene Pav_sc0001786.1_g040.1.mk
Chromosome name PAV_r1.0chr4
start 26205177
end 26208421
PAV_r1.0 name Pav_sc0001786.1
start 3351
end 6595
direction +
Annotation NR PREDICTED: putative Peroxidase 48
Sequence CDS ATGATGAGTGCAATGAAAGGGTGGGCCTTTGCTCTGGTGGTGATCTTCTCTGTGCTTCTG TCATGGAGCATCCCAAGAGGCGAGTCAGAGAGAGCCTTTCTCTCTTTCTCCTCCCATGAA CCACTGGTCAGAGTGGTTTATCTGGCGTCTGCGGATGAAGGCCAAGATTTCTTCATGGAG ATGACAGATTCTGTTGCAACGAACATCGGGTACGATTTCTACCACGATACATGCCCTGAA GCTGAGACCATTGTGAGGTCTATGATGGCTCAGATTTACTCCCAGCACAAGAATGTCTCT GCTCAGCTTCTGCGCCTCTTTTTCCATGATTGCTTCATTCAGGGTTGTGATGCTTCGGTC CTCTTGGATCACAGCAATGGGAATAAAAACCATTCCATAGAGAAGCAGGCTGTGCCAAAT AAGACCTTGAAGGGATTTGATAAAATTGATCAGATCAAGGAGGTGCTCGAAAATGTTTGT CCTGCAGTGGTATCTTGTGCTGACATTCTTGCTCTTGCCACTAGAGATGGGGTTGTTCTG GCTGGTGGTCCCTTTTATCCACTTGTCACTGGTAGAAGAGATAGTGCCCGCTCCTATTAT GATGAAGCCATGGCTGAGATTCCAAAACCTGATGATAATATCACTCAGACACTTCATCTG TTCTCACTCAGAGGTTTTACTGACAGAGAAACCGTCAGTCTTCTAGGAGGGCACAACATT GGGAAGATTGGATGTGAGTTCATTCAGTCTCGCCTTCACAACTTCAGGGGGACAGGGAAA CCAGACCCAACTGTTTCTCCTAGTTTCTTCAATGAGATGAGAGTTTTCTGTGAAGACAAT GGTAACAAGAAGAGTAGCCAAGGATCACCCATGGCAGCCCCCACGGCGTTTCCCATGGCA TCCTCCACGGCGTCTCCCATGGCATCCTCCATGGCAGCATCCATAGCATCATCCCCAATG GCATCAAGGGGCATGAGTGAGAAGCCTGCGGGGAGGGGGATGCCATACTTTCAGCAACTG TCATCATCTGTATCGTCTGGGGCAGGCTTTGACACTCATTACTACCAGAGCTTGTTGAGA GGCAGAGGACTTCTCTTTGCTGATCAGCAATTGATGGCTAATGAGAGGACAGCCAGATTG GTGAGAGCTTATGCTTCAGACGATTGA
PEP MMSAMKGWAFALVVIFSVLLSWSIPRGESERAFLSFSSHEPLVRVVYLASADEGQDFFME MTDSVATNIGYDFYHDTCPEAETIVRSMMAQIYSQHKNVSAQLLRLFFHDCFIQGCDASV LLDHSNGNKNHSIEKQAVPNKTLKGFDKIDQIKEVLENVCPAVVSCADILALATRDGVVL AGGPFYPLVTGRRDSARSYYDEAMAEIPKPDDNITQTLHLFSLRGFTDRETVSLLGGHNI GKIGCEFIQSRLHNFRGTGKPDPTVSPSFFNEMRVFCEDNGNKKSSQGSPMAAPTAFPMA SSTASPMASSMAASIASSPMASRGMSEKPAGRGMPYFQQLSSSVSSGAGFDTHYYQSLLR GRGLLFADQQLMANERTARLVRAYASDD


| Top |