Cherry SNP DataBase

Gene information

Gene Pav_sc0001786.1_g160.1.mk
Chromosome name PAV_r1.0chr4
start 26251638
end 26262641
PAV_r1.0 name Pav_sc0001786.1
start 49812
end 60815
direction +
Annotation NR PREDICTED: ultraviolet-B receptor UVR8
Sequence CDS ATGGCAGAAGAGGGAGCCAGTGAAGTCAGTGGTGCTCCAATCCGCCGTGTCCTTCTCATC TCCGCTGGGGCCAGTCACTCTGTTGCTCTTCTTTCTGAAAATGTTTTTTGCTCCTGGGGA CGAGGAGAGGATGGGCAGTTAGGCCATGGTGACGCTGAAGATCGACTGTCACCGACACAT TTGAGTGCATTGGATGGCCATGAAATAGTATCTGTTACTTGTGGAGCTGATCATACAATT GCTTACTCTGACTCATGTACACAAGCGTATAGTTGGGGATGGGGTGACTTTGGGAGGTTG GGTCATGGTAATTCCAGTGACTTGTTTACACCTCAGCCAATAAAGGCATTATATGGTCTG AGGATAAGGCAAATTGCTTGTGGGGACAGCCACTGTTTGGCTGTGACGATGGAAGGTGAG GTGCAAAGTTGGGGGAGGAATCAAAATGGCCAACTTGGTCTTGGTACCACAGAAGACTCT CTTGTGCCACAGAAGATTCAAGCGTTTCAGGAAATATCTGTCAAAATGGTTGCTGCTGGT GCTGAACATACTGCAGCTGTCACAGAAGATGGATCACTCTATGGATGGGGTTGGGGCCGA TATGGAAACTTGGGCCTAGGTGACAGGAATGATCGCTTGGTTCCGGAGAAGGTTTCTATG GTTAATAGTGAGAAGATGGTTATGGTTGCGTGTGGATGGCGGCACACAATATCTGTTTCT TCATTGGGTCGATTATACACGTATGGGTGGAGCAAATATGGTCAACTAGGACATGGGGAT TTTGAGGATCACCTTGTTCCTCACAAGCTAGAAGCCTTGAGTAACAACTTTATTTGTGAG TCCTTTGTGTTAACTGCTTCTTGCCTTGAATCTTACCAGACAGCTGGCGGTTGGAGGCAT ACTATGGCACTCACATCTGATGGAAAACTGTATGGCTGGGGTTGGAATAAGTTTGGACAG GTTGGAGTTGGGGACAATATTGATCACTGTTCACCTGTGCAAGTTAAATTTCCTCATGAG CAGGCACATTCTTATTACTACTATGTCTTTTTTACTTTTTTTATTTTGGACAGGTTGGAG TTGGGGACAATATTGATCACTGTTCACCTGTGCAAGTTAAATTTCCTCATGAGCAGGCAC ATTCTTATTACTACTAAAGTAGTTCAAATAACATGTGGATGGAGACACACGCTTGCTGTT ACTGAAAGACAAAATGTTTTCTCCTGGGGGAGGGGTACCAATGGACAGCTTGGGCATGGA GAATCAATTGACCGGAATGTTCCAACAATTATAGAGTCTTTGAGTGTTGATGGATCTACC GGGCTACAGATAGAATCTTCAAAAGTTGATCCAGCAACAGGGAAAACTTGGGTGTCACCA TCAAAGAGATATGCTGTTGTTCCAGATGAAACTGTCCGAGGGCAAACATCTGCTTCAGTC AAGGGTAATGGGAATGATGTAAGTGTTCCACAGTCCGACGTGAAACGCTTACGGTTTTGA
PEP MAEEGASEVSGAPIRRVLLISAGASHSVALLSENVFCSWGRGEDGQLGHGDAEDRLSPTH LSALDGHEIVSVTCGADHTIAYSDSCTQAYSWGWGDFGRLGHGNSSDLFTPQPIKALYGL RIRQIACGDSHCLAVTMEGEVQSWGRNQNGQLGLGTTEDSLVPQKIQAFQEISVKMVAAG AEHTAAVTEDGSLYGWGWGRYGNLGLGDRNDRLVPEKVSMVNSEKMVMVACGWRHTISVS SLGRLYTYGWSKYGQLGHGDFEDHLVPHKLEALSNNFICESFVLTASCLESYQTAGGWRH TMALTSDGKLYGWGWNKFGQVGVGDNIDHCSPVQVKFPHEQAHSYYYYVFFTFFILDRLE LGTILITVHLCKLNFLMSRHILITTKVVQITCGWRHTLAVTERQNVFSWGRGTNGQLGHG ESIDRNVPTIIESLSVDGSTGLQIESSKVDPATGKTWVSPSKRYAVVPDETVRGQTSASV KGNGNDVSVPQSDVKRLRF


| Top |