Cherry SNP DataBase

Gene information

Gene Pav_sc0001786.1_g210.1.mk
Chromosome name PAV_r1.0chr4
start 26290074
end 26302711
PAV_r1.0 name Pav_sc0001786.1
start 88248
end 100885
direction +
Annotation NR PREDICTED: exocyst complex component SEC6
Sequence CDS ATGGTCAATCTGTATACTGAGCGATTCGTTCAAATGCTTAGATTACTCAGTGACAGGGCA AATGAAATGACGAACATAGAGATTTTAAAGGTAACTGGTTGGGTGGTTGAATACCAAGAA AATCTGATTGGGCTTGGGGTTGATGAGTCCCTTGCTCAAGTGTGTTCTGAGAGTGGTTCC ATGGATCCCCTTATGAATTCATATGTTGAGAGAATGCAAGCTACAACAAGGAAATGGTAC TTGAATATCTTAGAAGCCGATAAAGTACAGCCACCAAAGAAAACAGAAGATGGGAAGCTA TATACACCAGCTGCTGTTGATTTATTCAGGATCCTAGGAGAGCAAGTGCAAATTGTTCGT GATAATAGCACTGATCTCATGCTGTACAGAATTGCCTTGGCAATTATTCAGGTAATGATT GATTTTCAAGCTGCTGAAAGGCAGAGACTCGAAGAACCTGCTTCAGAAATTGGTTTGGAA CCTTTATGCGCAATGGTTAACAACAACTTGCGCTGCTATGATCTTGCAATGGAGCTAAGT AATAGCACTTTGGAAGCTCTTCCACAAAACTATGCTGAGCAGGTCAACTTTGAAGACACA TGCAAAGGTTTCTTAGAGGTTGCAAAGGAAGCCGTGCATCAAACTGTCAGTGTTATCTTT GAAGATCCAGGAGTGCAGGATTTACTTGTCAAGCTTTATCAGAAGGAGTGGTGTGAAGGA CAGGTTACTGAGTATCTAGTTGCAACCTTTGGTGATTATTTTGCAGACGTGAAGATGTAT ATTGAAGAAAGATCATTCAGGAGATTTGTTGAGGCTTGTTTGGAGGAAACAGTGGTTGTT TACGTTGATCATCTTCTAACACAGAAGAACTACATCAAGGAAGAGACCATTGAGAGGATG AGATTAGATGAAGAGGTTCTGATGGATTTCTTTAGGGAGTATTTAAGTGTTTCTAAAGTT GAAAGCAGAGTCAGAATACTGAGTGATTTGAGAGAACTTGCTTCTGCAGAGAGCCTGGAT ACCTTCACCCTCATTTACACAAATATTCTTGAACATCAACCTGACTGTCCGCCTGAGGTT GTAGAGAAGCTTGTTGCATTGCGAGAAGGCATACCACGGAAGGATGCGAAGGAGGTCGTA CAAGAGTGCAAAGAAATATATGAGAATTCTCTTGTCAATGGGAACCCAGCAAAATCAGGT TTTGTTTTTCCAAGAGTGAAGTGTTTATCAAGTTCCAAGGGATCCATATGGCGGAAGCTA ACTTAG
PEP MVNLYTERFVQMLRLLSDRANEMTNIEILKVTGWVVEYQENLIGLGVDESLAQVCSESGS MDPLMNSYVERMQATTRKWYLNILEADKVQPPKKTEDGKLYTPAAVDLFRILGEQVQIVR DNSTDLMLYRIALAIIQVMIDFQAAERQRLEEPASEIGLEPLCAMVNNNLRCYDLAMELS NSTLEALPQNYAEQVNFEDTCKGFLEVAKEAVHQTVSVIFEDPGVQDLLVKLYQKEWCEG QVTEYLVATFGDYFADVKMYIEERSFRRFVEACLEETVVVYVDHLLTQKNYIKEETIERM RLDEEVLMDFFREYLSVSKVESRVRILSDLRELASAESLDTFTLIYTNILEHQPDCPPEV VEKLVALREGIPRKDAKEVVQECKEIYENSLVNGNPAKSGFVFPRVKCLSSSKGSIWRKL T


| Top |