Cherry SNP DataBase

Gene information

Gene Pav_sc0001794.1_g350.1.mk
Chromosome name PAV_r1.0chr6
start 18346845
end 18349977
PAV_r1.0 name Pav_sc0001794.1
start 166789
end 169921
direction +
Annotation NR PREDICTED: protein NRT1/ PTR FAMILY 5.6
Sequence CDS ATGGAAGAGAGAAAGGGAGCAAAACCAAGCAAGGTTGAAGATGGGGAGAAATGGGTTTAT GATTCTTCTCTGGATCATAAAGGAAATGTTCCTCTCCGAGCTCGAACTGGTGTTTGGAAA GCCTCTCTCTTCATCGTTGCAATTGAGTTCAGTGAGCGGTTGAGTTACTTTGGAATAGCA ACTAGCTTAATTATCTACCTCACGAAAGTAATGCACGACGACCTCAAAGTCGCAGCTAAA AGTGTCAACTACTGGTCTGGTGTCACCACACTCGTCCCACTATTTGGAGGCTTCATAGCT GATGCTTACTTGGGTCGCTTCAAAACAGTTCTTGCTTCATCCATCATTTACCTCCTGGGT TTGATTCTTCTATGCATGTCCTGGTTCGCACCGAGCTTAAGGCCTTGTGACACTAAATCG TGTCATGGACCAAGGAAAATTCATGAAGTGGTGTTCTTCCTAGCCATCTACTTGGTCTCT ATAGGGACTGGGGGTCATAAGCCAGCTTTGGAGAGCTTTGGAGCTGACCAGTTTGATGAT GATCACCCTGAAGAAAGAAAGCAGAAGATGTCCTATTTCAATTGGTGGAATTTTGGCCTC TGTTGTGGGCTTTTACTTGGGGTGACTGTGGTTGTGTATGTGCAAGACCATGTGAGTTGG GGTGTTGCTGATATAGTTCTCACTGCAGTTATGGCTGTGTCACTTGTTATCTTCATCGTT GGAAGGACAAATTACCGTTATAGGAAACCGACTGGGAGCCCCTTGACACCAATGTTGCAG GTTCTTGTAGCAGCCATTGCTAAGAGAAGTCTGCCTCACCCTTCTGACCCTGCTCAGTTG TATGAAATTCCCAAATCAGAGAAGGTCCATGGAAGGCTTCTGTGCCACACCAAGAATCTC AAATTTCTCGACAAGGCGGCGATCATAAGCGCTCAAAACTTGGCCGAGAAGCCAAGTCCT TGGAGACTAGCCACTGTGACCAAGGTAGAGGAGATGAAGCTTGTGCTCAACATGATCCCC ATCTGGCTAGCGACTCTACCATTCGGAATGTGTGTAGCACAAGCCTCCACATTCTTCATC AAACAAGGAGCCACCATGAACAGAAACATAGGCAACGGTTTTGAGATCCCCCCAGCCTCA ATCTTCTCACTTGCAGCCATTGGAATGATCATCTCCGTCACATTCTACGAAAAACTCCTC GTCCCAGTCCTAAGAAGAACAACAGGAAACGAGAGAGGCATCAACATCCTGCAAAGGATC GGGATCGGAATGGTTTTCTCCATTGCCACAATGGCGGCAGCTGCCTTGGTGGAGAAGAAA AGACTTGGTGCTGTGGAGAGTGACCCAGTAAAGGGTTCACATTCCATGAGCGTCCTGTGG TTGGCGCCTCAGTTTGTGATCATTGGGCTTGGAGATGGCTTCACTCTGGTGGGCTTGCAG GAGTATTTTTACGATCAAGTCCCTGACTCTATGAGAAGCTTAGGCATTGCGTTTTACCTC AGTGTGATCGGAGCAGGGAACTTCCTCAGCAGCCTCTTGATCACAGCCGTTGATCACATC ACGGAGAAGGGTGGGAAGAGCTGGTTTGGCAAGGATCTGAACAGCAGCAGATTGGACAGG TTTTACTGGGTTTTGGCTTGCATTGCTGCAGCAAATTTGTGTGTTTATGTTTTCTTGGCT CGGCGTTACTCTTACAAGACTGTGCAGAAGGTGGCTGTAGTGGCTGATTGCTATGAAGGT GAGCTGGAAAAGGGAGGTCCAATGGCATGA
PEP MEERKGAKPSKVEDGEKWVYDSSLDHKGNVPLRARTGVWKASLFIVAIEFSERLSYFGIA TSLIIYLTKVMHDDLKVAAKSVNYWSGVTTLVPLFGGFIADAYLGRFKTVLASSIIYLLG LILLCMSWFAPSLRPCDTKSCHGPRKIHEVVFFLAIYLVSIGTGGHKPALESFGADQFDD DHPEERKQKMSYFNWWNFGLCCGLLLGVTVVVYVQDHVSWGVADIVLTAVMAVSLVIFIV GRTNYRYRKPTGSPLTPMLQVLVAAIAKRSLPHPSDPAQLYEIPKSEKVHGRLLCHTKNL KFLDKAAIISAQNLAEKPSPWRLATVTKVEEMKLVLNMIPIWLATLPFGMCVAQASTFFI KQGATMNRNIGNGFEIPPASIFSLAAIGMIISVTFYEKLLVPVLRRTTGNERGINILQRI GIGMVFSIATMAAAALVEKKRLGAVESDPVKGSHSMSVLWLAPQFVIIGLGDGFTLVGLQ EYFYDQVPDSMRSLGIAFYLSVIGAGNFLSSLLITAVDHITEKGGKSWFGKDLNSSRLDR FYWVLACIAAANLCVYVFLARRYSYKTVQKVAVVADCYEGELEKGGPMA


| Top |