Cherry SNP DataBase

Gene information

Gene Pav_sc0001797.1_g430.1.mk
Chromosome name PAV_r1.0chr3
start 3086701
end 3090325
PAV_r1.0 name Pav_sc0001797.1
start 246327
end 249951
direction -
Annotation NR PREDICTED: IAA-amino acid hydrolase ILR1-like 4
Sequence CDS ATGGAGTTCCACATGCAAGTCTCTTTGATTATGGTCCTTTTTGTGTTTGGTCCAACAACT ATATTCACAAGTTCCTCTGTGAGCTCAAATGGGCTCTCAGAAATCCCCTTCAAGTTACTT GATTTTGCCCAGAAACCTCAAGTGTTTGATTGGATGTTGGGAATCAGAAGGAAAATACAT GAAAACCCAGAACTGGGTTATGAGGAATTTGAAACCAGTAAGCTGGTCAGAGCAGAATTG GATAAAATGGGTATTGACTATAAATACCCAATTGCGGTTACAGGTGTTGTAGGGTTCATT GGCACCGGAAAACCGCCTTTTGTTGCAATAAGAGCTGATATGGATGCTCTGGCTATGCAG GGAACAGTTGTTCTTCTATTTCAACCAGCAGAGGAAGGAGGAGCAGGGGCTAAGAAAATG ATAGATGGTGGAGCATTAGAGAATGTTAATGCTATTTTTGGGTTGCATGTTGCAAACCGC GTACCTATAGCTGAAGTGGCCTCCAGACCTGGTCCCTTTTTTGCAGGAAGTGGCTTCTTT GAAGCCACAATAAGTGGAAAAGGCGGTCATGCAGCCATTCCTCAGCATGCAATTGACCCG ATACTGGCAGCGTCAAATGTGATTGTCAGCTTGCAACATCTTGTTTCACGTGAAGCTGAT CCACTTGACTCACAGGTAGTCACGGTTGGAAAATTTCAAGGAGGTGATGCATTCAATGTT ATTCCAGATTCTGTCAGAATTGGTGGCACTTTCCGTGCCTTTACAAGGGAGAGCTTAATG CAACTCAAGCAGCGCATTAAGGAGGTCATAATGGGACAAGCTTCTGTACAAAGGTGCAGT GCAACTGTCAATTTCCTTGAAGATGAGAAACCTTTGTCACCCCCGACCATAAACCATAAG GACCTGCACGAACACTTCCGGAATGTAGCTGGAGATATGCTTGGCATCCACAGAGTCAAA GACCATCAACCATTGATGGGATCTGAGGATTTTGCATATTACCAAGAGGCAATACCTGGA TACTTTTTCTTGCTTGGAATGGCAGATGACAAACTTGGACCTCTGCATATGCCACATTCA CCTCACTTCCAAATAAATGAAGATGCACTTCCTTTTGGTGCTGCACTTCACGCTTCTTTG GCTATTAGGTATTTGCTTGAACTCCAACAGGAAGTTCCTTTGCCAGCACAAGAATACCAT GATGAATTATAA
PEP MEFHMQVSLIMVLFVFGPTTIFTSSSVSSNGLSEIPFKLLDFAQKPQVFDWMLGIRRKIH ENPELGYEEFETSKLVRAELDKMGIDYKYPIAVTGVVGFIGTGKPPFVAIRADMDALAMQ GTVVLLFQPAEEGGAGAKKMIDGGALENVNAIFGLHVANRVPIAEVASRPGPFFAGSGFF EATISGKGGHAAIPQHAIDPILAASNVIVSLQHLVSREADPLDSQVVTVGKFQGGDAFNV IPDSVRIGGTFRAFTRESLMQLKQRIKEVIMGQASVQRCSATVNFLEDEKPLSPPTINHK DLHEHFRNVAGDMLGIHRVKDHQPLMGSEDFAYYQEAIPGYFFLLGMADDKLGPLHMPHS PHFQINEDALPFGAALHASLAIRYLLELQQEVPLPAQEYHDEL


| Top |