Cherry SNP DataBase

Gene information

Gene Pav_sc0001801.1_g100.1.mk
Chromosome name PAV_r1.0chr6
start 9475916
end 9485720
PAV_r1.0 name Pav_sc0001801.1
start 56062
end 65866
direction +
Annotation NR PREDICTED: uncharacterized protein LOC103327943 isoform X1
Sequence CDS ATGCTAAATTCTGGGAATAATGTAAACCGGGGTAGTGCAACGCTATCATCAGCTATGCCT CCTTTGCCCCAGTGTTTGCCTTTGGAGCCCATTATCTTAGGCAATCAAAAATATACACGC TCAGGAGAACTTAGAAGGGTTTTGGGCTTTCCTCATGGTAGTATATCGGATGACCATTCT TTTGGAGTTGCCCATCCGAAACCTCCACCACCGGTGGCAACAGAGGAGTTAAAGCACTTC AAGGAAAGCGTGCAAGATGCGTCTAGAAAGGCCAGGGACAGAGCAAAAATGTTGCGTGAA TCCATTTTCAAATTGGATAAGTACAGAGAAGCTTTGAGTTCAAAGAAGAGACAGAGAAGC GATCTTTCATCGAGTGAGAGGTCCAGTGGAGCAAGTTTAGTGAAATTGGGAAGTCAAATT CATAAAAACCCTCAAGAGAATATGACTCAAAGATTGGAAGACAGGGCCAAGAGCGTTGGG TTCAATAAACGCGTACGGACGTCAGTGGCTGATGTGCGGGCAGATGTTAGGTCAGCTGCC ACCTCAAGGCAGCAGGTGACCACAGACAAGGATGAAAATAAGCTTCAGGCTGTTAGTGGG GCTTCTGCTAGGATTGAAGAAAAGACCCGCAGATTGCTTGCTGGAGGTGAAGGGTTGGAT CACAAAATAAAAAAGAAACGTTCGGTGGGAGCAGTGAGTAATAGAATTATAGGTGGTGAA CGGGATATAAAACGAGCTATGCATCCAAAGCTGAGTGGTGATTCTAAGCTACGCATATGT GATGCTCAAGGTTTCAGACTAAAATCTTCACTTGGAGTTGGTGGAATCAATAAGTCGGCT GAACCATCTTTTGAACCTTCTAATCTCAGTACCTGTACAGTACTCAAGAATGAGCTGGAA AGTGCTCCTGTTCCAAAAGACCGTTCAGCTGTATTAGAGCAGAGGGTTGTGTTGAAAGGA AACATTAAGCTAAATCCTCCGGAGGATAACCGTGCAGGAAGTCCTAATCCTGTGATAAAA GGAAAGGTTTCTAGGGCACCACGAACTGGTTCCGTTACAAATATAGACTCATCGCCTAAT GTTCACCCTTCATCCGGAGCTTTTCAAGGTTTGGAACAGCCTACTGGTCAAAACAAAGTC CAAGTAGCAAATGTGATGAATAATCAGAAGTGTGCAACATCAAATGGTTCTTCTGTACAT CCTATGGCCCAGTGGGTTGGTCAGAGATCACATAAAAGCTCTCGCACAAGGAGAACAAAT TTAGTTTCTCCTGTAACAAACAATGCTGAGGCTCAGATTTCCTATCAAGGCGCTGCAACT TCTGATTTTAGTGCTAGAACTTCTTATGTTGGGACCAATGGATCACAAGTTACGAGCAGT TTAGATAATCATACCGCAAAATCTAAAAGAGAACTTCAGAATGTTTCATCTCCATATGGG TTATCTGGAAGTGAAGAATCGGGAGCTGGGGAAAAAAAGTTGAAAGAGAAGGGAATGGAC CGCGGTGACATTGCCTTAGCTGCAGATGAAAAAGTTGGGGATCACTTACTGTCCATCAAG AAGAATAAATCACCAACTAATGACATTGGAGATGGTGTGCGAAGACAAGGAAGAAGTGGA CGAGGCCCATCTTTGACAAGGCCTGGGATTCCTCCAGTTATGGAGAAACCAGAGATTTTA CCAACCACAAAGCCTCTTCAAGGGATGAAACCTATGTCCGATAAGAATAGAAGTAAAACA GGTCGTCCACCCTCGAAAAAGCTGAAAGATCGCAAGGGGTCAACTCGTGTTGGGCCAATA GCATATCATGACTCACCCGATTTCACAGGTGAATCTGATGACGATCATGAAGAACTATAT GTTGCTGCCAATTCTGCTCGGAATGCTAGTAAACTTGCAAGTTCTGGCCCATTTTGGAAG AATGCTGCCAATTCTGCTCGGAATGCTAGTAAACTTGCAAGTTCTGGCCCATTTTGGAAG AAAATGGAAACGGTTTTTGGTTCTCTAAGCTCGGAGGACATATCCTACTTACAGCAGCAG CTAAGTTTTGCAGAGGAGCTTGGTGCGAGTTTGTCTCAGATGTTTGGCGATGAATATAAT GTTTCGGGTGTTTTTATGCATAGAGAATTCCCTAATTGTTCTGGGGAAAGACAAGGGAAC CATTTTAATCAAGATTCATCGAAGACTGATGCTTTATGTGAAAATTTTGACATGAGAAGG TTGGAAAGGGCTACTCCATTATACCAAAGAGTTCTTTCTGCTTTAATTGAAGAAGATGAA AGTGAAGAACTGTACCATCATAGTGAAGGGAAAAATTTGCACCTACGGTGTGCGAGTGAT GATTCTCATTGTGGTTCATGTAATCAGATTGACGTTGAACCCAAAGATTGGGACAGGATA GAATCTGAAGTTGAGTCGCAAGGGGATTTTCAGACTCAGAAAAATAGCTTGCTGGACAGA CTTTCTTGTGACAGAAGTGCTGCAACTAATACATTTAGAAATAGAAGCATGCCCAGTTCT GTACACAATCATGAACAGTGGCAGGCAGATGAGGATGTTTCACATTCTGATGTGGGGCAT GCCTGTGAAATATGTCCTACTGATCTTGGTCATCTGCAACCTAGGGAACTCAAGACTACT AACTTGCCTTCCTCAGAGTGCCAATATCAATTGATGTGCCTGGATGACAGGCTTCTCCTG GAGCTGCAGAGTATTGGTTTATGTCCGGAGACATTGCCTGATCTTACAGAAGGAGAAGAA GTGATTAATCAAGATATAATGGGACTCAAGCAAGGGCTGCATCAACAGATTGCGACGAAG AAGAAACACTTGGCAAAAATTGATAAAATTATTCAGAAAGAAAGAGCTGCAGAAAGACGG AGAATTGAACTAGTTGCAATGGATCAGCTTATTGAGATTGCTTACAGGAAACAACTGGCT TGCCGTGGGAGTAGTGGTTCAAAAAGTGCAGTCCGTAAGGTTTCAAAACAAGTGGCATTG GGTTTTCTCAAACGCACACTTGCCAGATGTCAAAAATTTGAAGAAAAGGGCATTAGTTGC TTTACTGATCCTGCACTGCAGAATGTTATCTTCTCTGAACTTTCATGCAACAATGCTGCA AAATCTGTCGACTGTGTTGGCTCTGGAACTGCTAGTAATACATGCAATGAAGGTTCCCAT CAAGCAGAAGTCAGAGGATCCGGTGCAGTATCCAGTGCGTCTGGGAGATATGATTCCCCT AGTGATAACCATGACAGGGGTTCATCAGGGGTTCTTCAAGCTGTCATTGACTCGTCTGGT CAAGCTTCTTCCAAGCATGGATCGATGTCGAACTTGAACAAGGGGAGAAAGAGGGAAGTG CTGATTACTGATGTTGTTGGACTTGGAAGTGCTTCCTCAAGGCTAACTTCAGCTCTTGAC AGCACTGTTCATGACCCAAAGGGAAACAGAGGTGAGAGAAATAAGGACCAAACCTTGGAT AACTTAAGAAACACTTCACCTAGTGGAGTTGGTAACACATCATTGGACAGCTCCCGAAGT GAACGCAAAACAAAAGGAAGATCCAAGCAAAAGAATACTCACTCATCAAGTCAATCAGTT CCTAATGTCAGCAATAAGAAAAGTAGGACGGGCCCACCATTGCGGAGTGATGCTCATACA CCGCCATCGTCTAAAGAGGCAGATGAACCCGCTGATATTGCAAATTTGCAACTACATGAA TTAGATTCACTGGAAGAGAACCAAGATCTCAGTTCATGGTTGAACTTCGATGAAGACGGC CTGCAAGATCATGATTCCATTGGTCTCGAAATACCAATGGATGATCTCTCAGAGTTGATG CTTATGTAA
PEP MLNSGNNVNRGSATLSSAMPPLPQCLPLEPIILGNQKYTRSGELRRVLGFPHGSISDDHS FGVAHPKPPPPVATEELKHFKESVQDASRKARDRAKMLRESIFKLDKYREALSSKKRQRS DLSSSERSSGASLVKLGSQIHKNPQENMTQRLEDRAKSVGFNKRVRTSVADVRADVRSAA TSRQQVTTDKDENKLQAVSGASARIEEKTRRLLAGGEGLDHKIKKKRSVGAVSNRIIGGE RDIKRAMHPKLSGDSKLRICDAQGFRLKSSLGVGGINKSAEPSFEPSNLSTCTVLKNELE SAPVPKDRSAVLEQRVVLKGNIKLNPPEDNRAGSPNPVIKGKVSRAPRTGSVTNIDSSPN VHPSSGAFQGLEQPTGQNKVQVANVMNNQKCATSNGSSVHPMAQWVGQRSHKSSRTRRTN LVSPVTNNAEAQISYQGAATSDFSARTSYVGTNGSQVTSSLDNHTAKSKRELQNVSSPYG LSGSEESGAGEKKLKEKGMDRGDIALAADEKVGDHLLSIKKNKSPTNDIGDGVRRQGRSG RGPSLTRPGIPPVMEKPEILPTTKPLQGMKPMSDKNRSKTGRPPSKKLKDRKGSTRVGPI AYHDSPDFTGESDDDHEELYVAANSARNASKLASSGPFWKNAANSARNASKLASSGPFWK KMETVFGSLSSEDISYLQQQLSFAEELGASLSQMFGDEYNVSGVFMHREFPNCSGERQGN HFNQDSSKTDALCENFDMRRLERATPLYQRVLSALIEEDESEELYHHSEGKNLHLRCASD DSHCGSCNQIDVEPKDWDRIESEVESQGDFQTQKNSLLDRLSCDRSAATNTFRNRSMPSS VHNHEQWQADEDVSHSDVGHACEICPTDLGHLQPRELKTTNLPSSECQYQLMCLDDRLLL ELQSIGLCPETLPDLTEGEEVINQDIMGLKQGLHQQIATKKKHLAKIDKIIQKERAAERR RIELVAMDQLIEIAYRKQLACRGSSGSKSAVRKVSKQVALGFLKRTLARCQKFEEKGISC FTDPALQNVIFSELSCNNAAKSVDCVGSGTASNTCNEGSHQAEVRGSGAVSSASGRYDSP SDNHDRGSSGVLQAVIDSSGQASSKHGSMSNLNKGRKREVLITDVVGLGSASSRLTSALD STVHDPKGNRGERNKDQTLDNLRNTSPSGVGNTSLDSSRSERKTKGRSKQKNTHSSSQSV PNVSNKKSRTGPPLRSDAHTPPSSKEADEPADIANLQLHELDSLEENQDLSSWLNFDEDG LQDHDSIGLEIPMDDLSELMLM


| Top |