Cherry SNP DataBase

Gene information

Gene Pav_sc0001801.1_g690.1.mk
Chromosome name PAV_r1.0chr6
start 9763950
end 9771343
PAV_r1.0 name Pav_sc0001801.1
start 344096
end 351489
direction +
Annotation NR PREDICTED: uncharacterized protein At2g27730, mitochondrial
Sequence CDS ATGGCGTCAAGGATGGCTGCAAGGTTTGTTACTCGGAGGCTGTCAAGCAGTGGAAAAGTG CTTAGCGAGGAGGAAAGAGCTGCAGAGACTGTTTATATTAAGGGCCCTAAACCGGAAGAG AACCCAACTGCAAGCTCAGAGGGCTCGATATCTGATGCCAAACCAAGTGGCTCTACCTCT GGAGAATCAACTGCCAAGGTATCCACTGACAAGTACCGGAATTATGCAGTTGTAGCAGGT GTTATAACTATTGGTGCTGCTGCAGGTTGGTATCTCAAATCTAGTGGAAAGAAACAAGAA GGCCCTAAACCGGAAGAGAACCCAACTGCAAGCTCAGAGGGCTCGATATCTGATGCCAAA CCAAGTGGCTCTACCTCTGGAGAATCAACTGCCAAGGTATCCACTGACAAGTACCGGAAT TATGCAGTTGTAGCAGGTGTTATAACTATTGGTGCTGCTGCAGGTTGGTATCTCAAATCT AGTGGAAAGAAACAAGAAGTGCAGGACTGA
PEP MASRMAARFVTRRLSSSGKVLSEEERAAETVYIKGPKPEENPTASSEGSISDAKPSGSTS GESTAKVSTDKYRNYAVVAGVITIGAAAGWYLKSSGKKQEGPKPEENPTASSEGSISDAK PSGSTSGESTAKVSTDKYRNYAVVAGVITIGAAAGWYLKSSGKKQEVQD


| Top |