Cherry SNP DataBase

Gene information

Gene Pav_sc0001836.1_g010.1.mk
Chromosome name PAV_r1.0chr2
start 4112404
end 4117659
PAV_r1.0 name Pav_sc0001836.1
start 3233
end 8488
direction +
Annotation NR PREDICTED: protein argonaute 4A-like
Sequence CDS GCAGTGAGGGTTCTTGATATCATACTAAGGCAGAATGCAGCAAAGCAGGGTTGTCTCCTT GTCCGACAGTCTTTCTTCCATAACAATCCGAGGAACTTCGCAGAGTTGGGAGCAGGTGTA TTAGGCTGCAGGGGTTTCCATTCAAGCTTTCGAGCTACCCAAGGGGGTCTGTCTCTGAAC ATGGATGTATCTACTACAATGATCGTGAAACCTGGTCCTGTTCTCAACTTCCTCATGGAG AACCAAAATGTTAAGACTCCATACCAGATTGATTGGATTAAGGCTAAAAGGATGCTAAAG AATCTAAGAATAACGACCTATTCCTCTAAGATGGAGTACAAAATCACTGGATTGAGTGAC AAACCATGCAAGGAGCAGAGGTTCTTTCTGAAAACAAAGAAAGGACAGGATGGTGATGGA GAGGAAATCACGGTTTCTAATTATTTTGCTCAATATAAACACTTACCAGTGCGCGATTCA GCAGATTTTCCATGCATCAATGTTGGGAAACCAAAGAGTCCATCTTACTTTCCACTTGAG CTCTGCAACTTGATTTCATTGCAACGCTATACCAAAGCTTTATCCAGTATGCAAAGGGCT TCGCTAGTGGAGAAGTCTCGGCAAAAGCCCCAAGAGCGGATGTCACTAAAAGTTGGCGAG GGACAAGATTTTTTCCCTCGGAACGGGCGTTGGAATTTTAACAACAAGAAATTGATACAA CCTGTGAAAATAGAGCGCTGGGCTATTGTCAATTTCTCTGCTCGCTGTGACACTCGGTAC CTGGTCAATAATATGTTGAAGTGTGGAGAGATGAAAGGAATTGTCATAAATGATCCATTT TTTGTATTTGAAGAGAACAACCAGAATAGACGTGACCCAGCTCCTGTTAGAGTGGACAAG ATGATTGAATACATAAAGTCCAAACTTCCAGGACCACCAGAGCTTCTGTTGTGTATTCTT CCAGAGAGGAAGAATTCTGACATATATGGTCCATGGAAAAGGAGAAATCTTTCTGAGCTT GGGATTGTAACACAGTGCATTGCTCCTGCAAAACTTAATGATCAGTACATCACAAATGTG CTCCTGAAAATCAATGCAAAGCTGGGTGGAATGAATTCCTTGCTACAAGTGGAGCATTCT CCTTCTATACCTTTGGTTTCTAAGTGCCCCACTCTGATTTTGGGAATGGATGTGTCACAC GGCTCACCTGGGCGTTCAGATGTACCTTCTATTGCAGCGGTGGTGAGTTCCAGGAACTGG CCCTTGATTTCTCGGTACCGAGCTGCTGTTCGTACTCAATCGCCAAAAGTAGAAATGATT GCTTCTCTGTTCAAGCCTGTATCAGATAAAGAAGATGCGGGCATAATCAGGGAATTGTTG CTAGACTTTTATGCTACTTCAAATAGCAGGAAGCCTGATCAGATAATTATTTTCAGGGAT GGAGTGAGTGAATCACAGTTCAACCAAGTCTTGAATGTGGAACTGGATCAGATTATTCAG GCCTGCAAATTCCTTGATGAGAGCTGGTCTCCAAAGTTCACGGTTATTGTTGCTCAGAAG AATCATCATACAAAATTTTTCCAGACTAGTTCTACTGAAAATGTGCCAGCTGGCACAATT ATTGACAACAAAGTTTGCCATCCCAAGAACAATGATTTCTACTTGTGTTCTCATGCTGGG ATGATTGGGACTACTCGACCTACTCATTATCATGTTCTATACGATGAACTCGGGTTTTCA GCAGATGATTTGCAAGAACTTGTTCATTCTCTATCATATGTGTACCAAAGGAGCACTACA GCCATCTCTGTAGTTGCTCCAATCTGCTACGCCCATCTAGCTGCCGCTCAGATTTCACAG TTCATCAAGTTTGATGATATGTCTGAGACTTCCTCAAGCCATGGTGGTGGTGTGACTGTT GCTGGTGGTGTGGCCGTGCCCGAGTTACCCCGGCTTCATGCTAATGTGATCAACTCCATG TTCTTCTGCTGA
PEP AVRVLDIILRQNAAKQGCLLVRQSFFHNNPRNFAELGAGVLGCRGFHSSFRATQGGLSLN MDVSTTMIVKPGPVLNFLMENQNVKTPYQIDWIKAKRMLKNLRITTYSSKMEYKITGLSD KPCKEQRFFLKTKKGQDGDGEEITVSNYFAQYKHLPVRDSADFPCINVGKPKSPSYFPLE LCNLISLQRYTKALSSMQRASLVEKSRQKPQERMSLKVGEGQDFFPRNGRWNFNNKKLIQ PVKIERWAIVNFSARCDTRYLVNNMLKCGEMKGIVINDPFFVFEENNQNRRDPAPVRVDK MIEYIKSKLPGPPELLLCILPERKNSDIYGPWKRRNLSELGIVTQCIAPAKLNDQYITNV LLKINAKLGGMNSLLQVEHSPSIPLVSKCPTLILGMDVSHGSPGRSDVPSIAAVVSSRNW PLISRYRAAVRTQSPKVEMIASLFKPVSDKEDAGIIRELLLDFYATSNSRKPDQIIIFRD GVSESQFNQVLNVELDQIIQACKFLDESWSPKFTVIVAQKNHHTKFFQTSSTENVPAGTI IDNKVCHPKNNDFYLCSHAGMIGTTRPTHYHVLYDELGFSADDLQELVHSLSYVYQRSTT AISVVAPICYAHLAAAQISQFIKFDDMSETSSSHGGGVTVAGGVAVPELPRLHANVINSM FFC


| Top |