Cherry SNP DataBase

Gene information

Gene Pav_sc0001862.1_g070.1.mk
Chromosome name PAV_r1.0chr3
start 15057468
end 15079415
PAV_r1.0 name Pav_sc0001862.1
start 27335
end 49282
direction +
Annotation NR PREDICTED: heterogeneous nuclear ribonucleoprotein 1-like
Sequence CDS ATGCCCTCTTTTTTGATCGGTGAAGGATCGGATGTTTCTAAATTGAATCCAGTAATACTT GCTTTTGAATCGGATTACAATCTGCAGAAAATGCAATCCGATAGTGGTAAGTTATTTATT GGCGGCATATCTTGGGACACAAATGAAGAGCGCCTGAAAGAGTATTTCAGTACTTTTGGA GAGGTGGTAGAAGCAGTGATCATGAAGGATCGGACCACAGGCCGTGCTCGTGGTTTCGGT TTTGTAGTTTTTGCTGACCCAACAGTGGCAGACAGCGTCATAATGGAGAAGCACAACATC GATGGAAGGATGGTTGAGGCCAAAAAGGCTGTTCCCAGGGATGACCAGAACATTTTGGGT AGAAGCAGTGGCAGCATCCATGGCTCTCCAGGTCCAGGCCGCACAAGAAAGATTTTTGTT GGAGGTTTAGCATCCACTGTCACGGAGAGTGACTTCAAGAAGTACTTTGAACAGTTTGGG ACAATCACAGATGTTGTGGTGATGTATGATCACAACACCCAGAGGCCGAGAGGCTTTGGG TTCATCACTTATGATTCAGAGGAGGCAGTGGACAAGGTTTTGCTTAAGACATTTCATGAA CTGAACGGGAAGATGGTTGAAGTCAAGCGTGCAGTTCCTAAAGAGTTATCACCTGGTCCC AGTCGCAGCCCTATTGGAGGATACAACTATGGTCTGAGTAGGGTCAATAGCTTCCTTAAT GGCTACACTCAGGGATATACTCCAAATACAGTTGGAGGCTATGGGCTTGGTAGGTTCAGT CCAGTTGCTGGTGGTCGAAGTGGATTTCCTCCATTTAATTCTGGTTATGGAATGGGTATG AATTATGAGCCAGGGTTGAGCCCAGGTTTTGGAGGAAATGCAAACTTTAATAGTAATATC AGCTACCCACGGGGAGTGAGTCCTTATTATATCAATAATTCAAATAGATTTAGCAGTCCC GTTGGGTATGATGGTGGTAATGGAGGAAACACATCATCTTTTTTTAGCTCGGTGACTCGG AACTTGTGGGGCAATGGGGGGCTTAATTATGGAACAAATTCCCAAAGTTCCAGTGCTTAC ATGGGATCAGGAAGTGGGACCATTGGAGGAAGTACGTTTGGCAATACTGGAGTTAATTGG CGTTCTTCAGCAATTTCAGCTCAAGGTGGAGGAAATAATGTTTCTAACAATAGTGGGAAT CTTGGTTATGGAGTTGGTGATAGCAGTTATGGTTTGGGAACCGGAGGTTATGGAAGAAAC AGTGGTACAAGTGTGGCCCCTACATCTTCATTTGCTGCGTCAAATGGTGGTTTCGATGGG TCCTTCTCTGACTTTTACAATGGTAATTCTGTTTATGGAGATTCTACTTGGCGATCATCG AATTCCGAGCGAGAAGGGTCTGTTCCCTTTGGTTATGGTCTTGGCGGTGCAGCTTCTGAT GTTTCAGCTAAAAGTTCGCCTGGTTATGTGGGTGGTTATAGTGTTGAAGCAAAAAAGGCT GTTCCCAGGGATGACCAGAATATTTTGGGTAGAAGCAGTGGCAGCATACATGGTTCTCCA GGCCCAGGTCGCACAAGAAAGATTTTTGTTGGAGGTTTAGCATCCACTGTCACGGAGAGT GACTTCAAGAAGTACTTTGAACAGTTTGGGACAATCACAGATGTTGTGGTGATGTATGAT CACAACACTCAGAGGCCAAGAGGCTTTGGATTCATTACTTATGATTCAGAAGAGGCAGTG GACAAGGTTTTGCTTAAGACATTTCATGAACTGAATGGGAAGATGGTTGAGGTCAAGCGT GCAGTTCCTAAAGAGTTATCACCTGGTCCCAGTCGCAGCCCTCTTGGAGGATACAACTAT GGTCTGAGTAGGGTTAATAGCTTCCTGAATGGCTACACTCAGGGGTATAATCCTAGTACA GTTGGAGGCTATGGACTTGGTAGATTCAGTCCAGTTGCAAGTGGTCGAAGTGGGTTTCCT CCATTTGCTTCTGGTTATGGAATGGGTATGAATTATGAGCCAGGGTTGAACCCAGGTTTT GGAGGAAATGCAAATTTTAATAGTAATATCAGCTACGGACGGGGGTTGAGTCCTTATTAT ATCAATAATTCTAATAGGTTTAGCAGTCCCGTTGGGTATGATGGTGGTAATGGAGGAAAC ACATCTTCTTTTTTCAGTTCTGTGACTCGGAATTTGTGGGGAAATGGGGGGCTTAATTAT GGAACAAACTCCACAGGTTCCAGTGCTTACAATGGATCCGGAAGTGGGAGCATTGGAGGA AGTACATTTGGAAACACTGGAGTTAATTGGCGTTCTTCGGCAATTTCAGCTCAAGGTGGG GGAAATAATGTTCCGAACAATAGTGGGAGTCTTGGTTATGGAGCTGGTGATAACAGTTAT GGTTTGGGAAGCGGAGGGTATGGAAGAAACAATGGAACAAGTGTGACCCCTACATCCTCA TTTGCTGCATCAAATGGTGGTTTTGATGGGGCCTTCGCTGACTTTTACACTAGTAGTTCA GTTTATGGTGATCCCACTTGGCGTTCATCAAATTCCGAGCGAGATGGGCCTGGTCCCTTT GGTTATGGGCTCGGTGGTGCAGCTTCTGATGTTTCAGCTAAAAGTTCTCCTGGTTATGTG GGTGGTTATAGTGTTAATAAGAGACAGCCAAATACAGGAATTGCTACCTAG
PEP MPSFLIGEGSDVSKLNPVILAFESDYNLQKMQSDSGKLFIGGISWDTNEERLKEYFSTFG EVVEAVIMKDRTTGRARGFGFVVFADPTVADSVIMEKHNIDGRMVEAKKAVPRDDQNILG RSSGSIHGSPGPGRTRKIFVGGLASTVTESDFKKYFEQFGTITDVVVMYDHNTQRPRGFG FITYDSEEAVDKVLLKTFHELNGKMVEVKRAVPKELSPGPSRSPIGGYNYGLSRVNSFLN GYTQGYTPNTVGGYGLGRFSPVAGGRSGFPPFNSGYGMGMNYEPGLSPGFGGNANFNSNI SYPRGVSPYYINNSNRFSSPVGYDGGNGGNTSSFFSSVTRNLWGNGGLNYGTNSQSSSAY MGSGSGTIGGSTFGNTGVNWRSSAISAQGGGNNVSNNSGNLGYGVGDSSYGLGTGGYGRN SGTSVAPTSSFAASNGGFDGSFSDFYNGNSVYGDSTWRSSNSEREGSVPFGYGLGGAASD VSAKSSPGYVGGYSVEAKKAVPRDDQNILGRSSGSIHGSPGPGRTRKIFVGGLASTVTES DFKKYFEQFGTITDVVVMYDHNTQRPRGFGFITYDSEEAVDKVLLKTFHELNGKMVEVKR AVPKELSPGPSRSPLGGYNYGLSRVNSFLNGYTQGYNPSTVGGYGLGRFSPVASGRSGFP PFASGYGMGMNYEPGLNPGFGGNANFNSNISYGRGLSPYYINNSNRFSSPVGYDGGNGGN TSSFFSSVTRNLWGNGGLNYGTNSTGSSAYNGSGSGSIGGSTFGNTGVNWRSSAISAQGG GNNVPNNSGSLGYGAGDNSYGLGSGGYGRNNGTSVTPTSSFAASNGGFDGAFADFYTSSS VYGDPTWRSSNSERDGPGPFGYGLGGAASDVSAKSSPGYVGGYSVNKRQPNTGIAT


| Top |