Cherry SNP DataBase

Gene information

Gene Pav_sc0001862.1_g090.1.mk
Chromosome name PAV_r1.0chr3
start 15080659
end 15083961
PAV_r1.0 name Pav_sc0001862.1
start 50526
end 53828
direction -
Annotation NR PREDICTED: putative MO25-like protein At5g47540
Sequence CDS ATGGCGAAAAAGTTGACAATGAAGGGTCTTTTCAAGCCGAAGGCGCGAAGCCCATTGGAG CTTGTAAAGCACACGCACGAGCTTCTCACGTTTCTTGATCGGAACATGGATGCGCGCGAG CAAAAGCGCAAAGAAAAGATGGATGAACTGAGCAAAGCAATCTTGGAGATAAGAACAGTT TTATATGGTGATGAGGAATCAGGGCCAAATAAAGACTCTTGTGCACAACTTACTCAGGAA TTTTTCAGAGGGGACACATTCAGGCTTCTCATTGTTTGCCTTTCAAAGCTCAACTTGGGG GCTCGTAAAAACGCCACTCATGTCGTTGCAAATTTGCTAAGGCAACGAGTTCAGTCCCAA TTGATTGCTTTAGAGTACTTGGAAAAGAATATAGATCTTATGGACATTCTGATAAAAGGC TATGAAGACAGCGGCGATGTTGCTCTGTCATATGGTGCAATTTCAAGGGAATGCATTCGT CGCCAGAATGTAGCAAGGTATGTCTTGGAATCAGACCACATGAAGAAGTTTTTCGATTAT ATACAAACTCCAAATTTCGACATAGCATCAGATGCTGCAGCTACTTTCAAGGAGCTCATG ACAAGGCACAAATCAACTGTTGCTCAATTTCTTTCTAAAAATTATGAGTGGTTTTTCCAA GAGTACAATTCTCAGTTGCTTGAGTCTTCAAATTATATCACCAAACGCCAGGCCATCAAG CTGTTAGGAGATATGTTGCTCGATCGCTCCAACTCTGCTGTGATGGTTCAATATGTCTGC TCTCTGGATAACATGAGAATCCTGATGAACCTTCTTAGGGATCCAAAGAAGACAATCAAG TTAGAGACCTTTCATGTGTTCAAGCTATTTGTTGCAAACCAAAATAAGCCTCCTGAGATT GTTAATGTGCTTATCACAAATAGGACCAAGCTTCTCCGTTTCTTTGATGACTTCACCATT GAGAAAGAGGATGAGCAGTTTGAAGCAGCCAAAGCTGATGTTATTAATGAGATTTCTGTT CTTGAACCCAAACCCAAGATATCTTCAATCCTCAGCTTTAGAAACAATTGTGAGGTCAAA TGTTAA
PEP MAKKLTMKGLFKPKARSPLELVKHTHELLTFLDRNMDAREQKRKEKMDELSKAILEIRTV LYGDEESGPNKDSCAQLTQEFFRGDTFRLLIVCLSKLNLGARKNATHVVANLLRQRVQSQ LIALEYLEKNIDLMDILIKGYEDSGDVALSYGAISRECIRRQNVARYVLESDHMKKFFDY IQTPNFDIASDAAATFKELMTRHKSTVAQFLSKNYEWFFQEYNSQLLESSNYITKRQAIK LLGDMLLDRSNSAVMVQYVCSLDNMRILMNLLRDPKKTIKLETFHVFKLFVANQNKPPEI VNVLITNRTKLLRFFDDFTIEKEDEQFEAAKADVINEISVLEPKPKISSILSFRNNCEVK C


| Top |