Cherry SNP DataBase

Gene information

Gene Pav_sc0001878.1_g040.1.mk
Chromosome name PAV_r1.0chr1
start 9900493
end 9911214
PAV_r1.0 name Pav_sc0001878.1
start 16869
end 27590
direction +
Annotation NR PREDICTED: NEDD8-activating enzyme E1 catalytic subunit
Sequence CDS ATGTCTAAGGACCCATCTCACCAGCCTGAGCCTGAAACCATGCCATTCTTTGAAGTTTTT AAGAAGTTTAAGCGTTTCAAGCTCTTTGAGCCGTCTTTGGGCGTTTTGGGTTTCTTCTTT GCCAGTGTCTGTGTAATTTTGTGCTTCTTCTACTTGGATTATAGAGCTGTGGTTAAAGGG TTTCGGTTCCCGGGACAATCGGAGCGGTTTATGTGGCTGCAGACAAACGGGTCGGTCAAG GATCCGAGGGTTGAGTTTTTAGAACAAAAGGGTGGTGGGTGTGATGTGTTTGAAGGGGAT TGGGTGTGGGATGAGTCCTACCCTTTGTATAACTCCAAAGATTGCCGCTTTTTGGATGAC GGCTTTAGGTGCACTGAGAATGGCCGGCCTGATTTATTTTATACCAAGTGGAGATGGCAA CCCAGACATTGCAACTTGCCTAGGGGTTGTTACTTCCAGGTAGGGGCAGAAGTAAAGATG GAAATGAGCGTAGAAGATGCATATCAACGCTCCATGGAGACTGTGGTGCACTGGATAGAC ACTAAAGTAAATTCAAGCAAGACTCAGGTTTTCTTTCGAACATACGCCCCTGTGCATTTC AGAGGCGGGGATTGGAAGACGGGGGGAAACTGCCATTCGGAGACTCTGCCTGAGCTAGGG TCCACATTGGTTCCTTCTCAATCTTGGGATCAATTCAGGATAGCCAATGCTGTGCTATCA GCTCACTCAAACACATCAAAGGCAACGGAAATTGATATATTAAATGTAACTCGAATGACT GCACGAAGAAAAGATGGGCATTCGTCTTTGTACTATTTGGGTCCTGAAGTTGGCCCTGCG CCTCTCCATCGCCAAGACTGCAGCCACTGGTGTCTGCCTGGAGTCCCTGACACATGGAAT GAGCTACTCTATGCGCTATTCCTAAAGCATGAGATGACCAGCAAATTTAACTCATCAACT TATAGGGCACAGAAGCAAAACAGCAACCAGGAGAAGACACACAGGCACTGTGGAAGGGAG AGAGAGAGAGCAATGGCAGCAGAACCCACTGCCCAAGAAAGCCGATCGAGGGACCTCGAC AAGCTCCTCCTCCGAACCGGCAATCTCGTCGGACCCACCTTCGAACCCGGTCCCGCACTG AGAGATGACCTCAAAGAGTACGGGAGAGTGTTGGTGGTTGGGGCTGGTGGGTTGGGCTGT GAACTGCTCAAGGACTTGGCTTTATCTGGTTTTCGAAAACTTGAGGTTATAGACATGGAT CGCATCGAGGTTTCTAATCTCAATCGCCAGTTCCTTTTCAGACTTGAAGATGTAGGTAAG CCAAAGGCTGAGGTGGCTGCAAAACGTGTCATGGAAAGAGTTAGTGGTGTAAATATTGTT CCACATTTTTGCCGGATTGAGGACAAAGAGCTTGAATTTTATAGCAAATTCAGCATTATT GCCCTCGGTCTTGATTCCATTGAGGCTCGGAGCTACATAAATTCTGTTGCTTGTAGTTTT CTTGAGTATGATTCTGATGATAGTGCACTAGAAGAAACAATCAAACCTATGGTAGATGGT GGGACTGAAGGTTTTCAGGGACATGCTAGGGTCATTGTGCCAGGGGTCACTCCATGCTTT GAGTGTACCATCTGGCTTTTTCCACCTCAAGTGAAGTTCCCTCTATGCACCCTTGCAGAA ACCCCTAGAACTGCTGCTCATTGTATTGAATATGCTCACTTAATTAAATGGGATGAGGTA CATAGCGGTAAGGCCTTTGATCCAGATGATCCAGAGCATATGAAGTGGGTCTACAATGAG GCTACCAAGAGAGCTGAGCTTTTCGGTATTCCCGGAGTTACATATTCCCTTACTCAGGGT GTTGTGAAGAACATCATACCAGCTATTGCTTCCACAAATGCGATTATATCAGCTGCATAA
PEP MSKDPSHQPEPETMPFFEVFKKFKRFKLFEPSLGVLGFFFASVCVILCFFYLDYRAVVKG FRFPGQSERFMWLQTNGSVKDPRVEFLEQKGGGCDVFEGDWVWDESYPLYNSKDCRFLDD GFRCTENGRPDLFYTKWRWQPRHCNLPRGCYFQVGAEVKMEMSVEDAYQRSMETVVHWID TKVNSSKTQVFFRTYAPVHFRGGDWKTGGNCHSETLPELGSTLVPSQSWDQFRIANAVLS AHSNTSKATEIDILNVTRMTARRKDGHSSLYYLGPEVGPAPLHRQDCSHWCLPGVPDTWN ELLYALFLKHEMTSKFNSSTYRAQKQNSNQEKTHRHCGRERERAMAAEPTAQESRSRDLD KLLLRTGNLVGPTFEPGPALRDDLKEYGRVLVVGAGGLGCELLKDLALSGFRKLEVIDMD RIEVSNLNRQFLFRLEDVGKPKAEVAAKRVMERVSGVNIVPHFCRIEDKELEFYSKFSII ALGLDSIEARSYINSVACSFLEYDSDDSALEETIKPMVDGGTEGFQGHARVIVPGVTPCF ECTIWLFPPQVKFPLCTLAETPRTAAHCIEYAHLIKWDEVHSGKAFDPDDPEHMKWVYNE ATKRAELFGIPGVTYSLTQGVVKNIIPAIASTNAIISAA


| Top |