Cherry SNP DataBase

Gene information

Gene Pav_sc0001953.1_g030.1.mk
Chromosome name PAV_r1.0chr4
start 7864605
end 7870092
PAV_r1.0 name Pav_sc0001953.1
start 12975
end 18462
direction +
Annotation NR PREDICTED: chaperonin 60 subunit alpha 2, chloroplastic isoform X2
Sequence CDS ATGCAGGGTTTACTTAATGTTGCTGTTGTTAAATGTCCTGGATTTGGAGAGGGAAAGAAA GCTCTTTTGCAAGATATTGCACTCATGACAGGTGCTGATTTTCTCTCTGGAGATTTTGGT TTGACCCTTGAAAGTGCAACATCAGATCAACTTGGAATTGCAAGAAGAGTGACAATAACA AGTAATTCAACAACAATAGTCGCTGACCCTTCTACTAAAGCTGAGATTCAGGCAAGAATA TTGCAGATCAAGAAGGATCTGGCAGAAACAGAAAATGCATACCTGTCGAGAAAGCTCTCT GAAAGAATTGCCAAGCTTTGCGGTGGAGTTGCCGTAATTAAGGTCTGTGATATGAAAGAG CTACAATATCTGATATCATACTGGACAAAGCTACTTTGCGGTGGAGTTGCCGTAATTAAG GTAGGAGCACATACTGAGGTGGAACTTGAAGATCGCAAACTCAGAATTGAGGATGCAAAG AATGCTACATTTGCTGCTATGGAGGAAGGGGTGGTGCCTGGTGGTGGCGCAACATACGTA CATCTGTCAGAATTCATTCCTGTCATAAAGAATTCTATGGAAGATACGGATGAGCAGATA GGTGCTGACCTTGTGGCAAAGGCTCTACTTGCTCCTGCAAAATCAATTGCAACTAATGCA GGGGATGATGGAGAAGTTGTTGTGGAGAAGACTAAAAGTTGTGATTGGAGAGTTGGGTAC AATGCAATGAATGGCAGCTATGAAGATCTTCCAGATGCAGGAGTTATAGATCCTTGTAGG GTTTCAAGATGTGCCCTTCAAATTGCAGTCTCCATTGCTGGGGTGGTTCTTACAACTCAA GCCGTATTGGTGGAGAAAACGAGAAAGAAAAAGCCGGCTGTTCCTTTTGTTCCCGGAATA ACTCCTCAGTGA
PEP MQGLLNVAVVKCPGFGEGKKALLQDIALMTGADFLSGDFGLTLESATSDQLGIARRVTIT SNSTTIVADPSTKAEIQARILQIKKDLAETENAYLSRKLSERIAKLCGGVAVIKVCDMKE LQYLISYWTKLLCGGVAVIKVGAHTEVELEDRKLRIEDAKNATFAAMEEGVVPGGGATYV HLSEFIPVIKNSMEDTDEQIGADLVAKALLAPAKSIATNAGDDGEVVVEKTKSCDWRVGY NAMNGSYEDLPDAGVIDPCRVSRCALQIAVSIAGVVLTTQAVLVEKTRKKKPAVPFVPGI TPQ


| Top |