Cherry SNP DataBase

Gene information

Gene Pav_sc0001954.1_g150.1.mk
Chromosome name PAV_r1.0chr2
start 3639783
end 3651998
PAV_r1.0 name Pav_sc0001954.1
start 68241
end 80456
direction -
Annotation NR PREDICTED: mediator of RNA polymerase II transcription subunit 15a-like
Sequence CDS ATGAAGATAATGTCAAGGTTGGAGGCAATGGTTCCTTCGTCATCAAAGTCAAACCCTCCC TATTCTGGTCTAAACACCTCGAATCCAGGTGGTAATCAAGGCCAATCAATTGCTGTTCAA TCCAGAGATCATTCTCAAGCACGGGAACAACATGCATTGCCTAATGTTCCAAATACCATT GCATCTGGTGGATTTTCTTCTAACTTAGCATCTGCACGGTCGACTGTCAGTGTTTCAGCT CGGGTTCCCTTGCCAAACAGTGCTACTGAAAATGCCAACTCGCAGAAGTCAGTAGGAAAT TTATCAGGGCAAGGGGCACCTATCAATGTTTCTGCCAATAATGTGAGACAGGAGCAAGGG AGACAACATTCACCCCACATTGGTACTCAGCAGAACCATGAGCAACTAAATCATCATCTT GGTATTCAGGTCAAGCAGGAAAACATCTCACCATCATGTATAGCCCAGCAAAAACAACTA CAGCAGTACCACCAGCAGCAGCAGCAGAAACTCTTAAAACCTGCTCAGAAACAGACCTCT CAACAATCTGTCATGCAAACTCCTGCCATACGACCTTCTGAGACACATGTTGCTCCACTT TCTGATCTTCGGCAGGATCAGATGTCTTCTTTCGAGCAGACAACACGCTCTGTGATTAAG AATCATCCTCACACAGCATCTAGGCAAATACACCAATCACAAGAGACTCCTGATATTCAT CAAAATGCATCATCAAGACCAGATAATCTAGTAATGCAATCACAAAAGCAACCACATTTG ATAGGTACTCCTGGCTTGCAGCAGCAACAGACTAGGTTACCAGGCCAACCAAATAATGTA CAACAATGGCTTCAGGTACAAAAAATGAATCTTCCAAGTGCACATCATGAACAACTGGCA GAAAGAAACAATATTTCTGTACTGCAACAAAGCTCGCAGCTCCTTGGAACACAATGTGCT AGCTCAGGCATGCGCCAATGCAATTTTAAAATGCAGGAGGAAACCCAACACACTGCTTCA GCTCTTCTGCCAAATCAAGGTCAACGGTCACAACCGCAGTCTCTCGAGAGGCAACTGAAC TCTCAATCACAGCCAGATAAGATGCGACAGCTGCCAAATCCAACAGAACAAGATCAGCAG CAAACATATCAAACATCAGGCAAGTTTTTAACACCTCTTAGTGATATGCTTCAAAAAGTA ACATATACAATCGAGCAGTTCAATTCTGTCACTCAACAGACAGAAAGGGTCAGTATTGAG AGATATAAAGCATTGAAGAATAGATTGAGGGAGATCATTTTGCATCTAAATGTGCCCAAA AGCAAAATTACACCTTCTTACAAGGAGAATCTGGGTTCAATGGAGAGGCAAATTCTGCTT ATTCTTCACACATATGGAAGGGCAAAGCCTGTTCCCTCACAGCAGCATGGACAACTTTCT TCTGATGTGCACTCTACGCGTCAAATGGTGCAACTTCATTCTCAAACTCCTCAAGTTCAT ACACACCAAGACGAAAGGAAGCTACCATTGCAGTCAGTGAACTTGCAGTGTTCTGCAACA AGCAATGTGACAAACTTGGTGAACAGTTCTAGGTCTCCAGCTGAGCATCCAACCCTGAAA CATGACATGGTGCATTTGAGAAAGAATTTGACTGAGAAATATTCAGGACAAGCAAATTCG TTGACCGCAGTGCAGCTGGTTGCCTTAGGATCCTCAAAAATCCCTACAGGCAGTCCTCAA AAACCTAGGGTTCAGACCTTGTCACAAATACCCGTACATGAAACCCAGTCTAATTTAAAT GCTCTTGATTCTAGCTGTAGTACACTTAAAGATATGCACCTCAAATTACCTAAAGAAGAG CCGGCTGTACAGACTCAAAACCCAAAGCAAGAACTTCGAAGGCACATGATCAAGGAGCAA CTAGTGCAACAACAGAAAATACTGCACCAGCATCATGAGCAGGTAAAGCTGCAGTCTGGA GCTTCATTTCCTCCTGCTGTGCCCAAAATTCTTGGTTCTTCCTGTCAAGAAATTCCTCAG TACTCTTCTCAGATTGACAAGAAAAATCTGCTGATACCCCTTACAAAAGCTAGAACGACT TTTGCCGCTGTTTTGGACATTGGTTCCATAGTGTGTACAACTGATAGAATATCAGGACCA GAAACCGATGGGGGATCTATAGGTTCGTTTGGTAAAGATTTTGTGGAAATGACCAATTCT CATTTGCTAAAGAGGTATTTGACCTGGCAAGATAACACCTTTCCAACAAGGAAAATTAAA CGCTGCAGAAGTACAGTGCCAATGCATGTTGTTGATAGCTTACCAGAGTTTAGTGATAAG GAGAAATTTGACTTGGATTCAACTGCAATATCTTACATCAGAAGGCCTAGGATTGAGGTG AAACAAACCCTCTTAGAAGAAATTACAGTAATCAACCACCAACTAATAGACACAGTACTG GATATCAGTGATGAAGACACCCCTCCAACAGTAGCCTCAGCCCCAATTAAAGTTGGTGAA GGAACCGTCGTCAGGTGCTCCTTCATTGCTGTGGCCATCAGTCCAAGTCTGAAGTCAGAG CAGCTTCCAATCCAGCCTTTACGATTGCTTGTTCCTGCAAATTATCCGTTGTGCTCCCCC ATATTTCTAGACAAGTTGAGAGTGGACATCAGTGATGAGCTAGAAGATCTTTCAGCAAAG GTGAAGTCAAAACTCAATATCTCTCTCCGGAGCTTGACGGAACCTTTGTCCCTTGGGGAG ATAGCCAGGACATGGGATGTTTGCGCCCGAGCGGCTATCTCTGAATATGCACAGCAGCTT GGGGGAGGAAGCTTCAGTTCTAAGTGTGGAACGTGGGAAGACTGTCTTAGTGCTGCTTGA
PEP MKIMSRLEAMVPSSSKSNPPYSGLNTSNPGGNQGQSIAVQSRDHSQAREQHALPNVPNTI ASGGFSSNLASARSTVSVSARVPLPNSATENANSQKSVGNLSGQGAPINVSANNVRQEQG RQHSPHIGTQQNHEQLNHHLGIQVKQENISPSCIAQQKQLQQYHQQQQQKLLKPAQKQTS QQSVMQTPAIRPSETHVAPLSDLRQDQMSSFEQTTRSVIKNHPHTASRQIHQSQETPDIH QNASSRPDNLVMQSQKQPHLIGTPGLQQQQTRLPGQPNNVQQWLQVQKMNLPSAHHEQLA ERNNISVLQQSSQLLGTQCASSGMRQCNFKMQEETQHTASALLPNQGQRSQPQSLERQLN SQSQPDKMRQLPNPTEQDQQQTYQTSGKFLTPLSDMLQKVTYTIEQFNSVTQQTERVSIE RYKALKNRLREIILHLNVPKSKITPSYKENLGSMERQILLILHTYGRAKPVPSQQHGQLS SDVHSTRQMVQLHSQTPQVHTHQDERKLPLQSVNLQCSATSNVTNLVNSSRSPAEHPTLK HDMVHLRKNLTEKYSGQANSLTAVQLVALGSSKIPTGSPQKPRVQTLSQIPVHETQSNLN ALDSSCSTLKDMHLKLPKEEPAVQTQNPKQELRRHMIKEQLVQQQKILHQHHEQVKLQSG ASFPPAVPKILGSSCQEIPQYSSQIDKKNLLIPLTKARTTFAAVLDIGSIVCTTDRISGP ETDGGSIGSFGKDFVEMTNSHLLKRYLTWQDNTFPTRKIKRCRSTVPMHVVDSLPEFSDK EKFDLDSTAISYIRRPRIEVKQTLLEEITVINHQLIDTVLDISDEDTPPTVASAPIKVGE GTVVRCSFIAVAISPSLKSEQLPIQPLRLLVPANYPLCSPIFLDKLRVDISDELEDLSAK VKSKLNISLRSLTEPLSLGEIARTWDVCARAAISEYAQQLGGGSFSSKCGTWEDCLSAA


| Top |