Cherry SNP DataBase

Gene information

Gene Pav_sc0001963.1_g500.1.mk
Chromosome name PAV_r1.0chr8
start 16751010
end 16756537
PAV_r1.0 name Pav_sc0001963.1
start 254011
end 259538
direction +
Annotation NR PREDICTED: phosphatidylinositol/phosphatidylcholine transfer protein SFH9 isoform X2
Sequence CDS ATGCCAGGAGAAGTAGTTGCGTTTCAAGAAGATGAAAAATCTAGAACTTTTGATTTCGAA ACCTCCGAGGACGAGAGGCGGTGGTCTCGCGGCAGATCTCTGAAGAAAAAGACCACGAAC GCTTCCCTGAGATTAACAAATAGTCTTAGAAAGCGCCGAAAACGTGTAGCCAATTGCCGG TACGCGTTGATTTCAATTGAAGATGTTCGGGATGCTGAGGAGGAAGAAGCTGTAATTACG TTTCGTGAGGCATTGGTTGCTAGAGATATGCTTCCGGCTCAGTACGATGATTATCATACA ATGCTGAGATTTTTGAAGGCGAGGAAGTTTGACATTCATAAAGCTGTCCACATGTGGGCA GAAATGCTCAACTGGAGGAAAGAGTTTGGAGTAGAATCTATTGTGAAGGATTTCGTGTAC AGTGAGTATGAAGAGGTTCAGCGTTTTTACCCTCATGGTTATCATGGTGTAGACAAGGAG GGACGGCCTGTTTATATTGAAAGAGTTGGCAAAGTTGAACCTAGCAAGCTTATGAATGTC ACCACAGTGGACCGGTTTCTAAAATATCATGTCCAGGGTTTTGAGAAGGCCTTTGCTGAG AAGTTTCCTGCATGTTCTATTGCAGCCAAAAGGCATATAGATTCTACAACAACTATACTA GACGTCCAGGGGCTGAATTGGGTGAGCTTTGGTAAGGTTGCACATGACCTTGTTATGCGC ATGCAGAAAATTGATGGTGATAACTATCCTGAGGTATTAGGCAACAAATTCAGAAGCAAG TTGTTGGAAGTTATAGACTCAAGTCAACTTCCAGATTTCCTTGGGGGAACTTGCTCATGT CCAAATGAAGGCGGGTGCCTTAGGTCTGGCAAGGGGCCCTGGAATGATCCAGAGATAGTA AAACTGGTACACATTGGAGAAACAATGGACTTGAGGAAAATCAATGGTTCTTCTGATGGC GATGATTTAGGAGTCAAACTGATTGCCTCTAAGGTTACAGAAAATGAAATAATATCTGCG CCTGAGTCAGGATCAGAAATGATGTCAAGTGTTTCTGGCTTCTTGCAATTGCTGACGTCT CATTCTGACAAGAGGAGGGCAAGTGACTCTGCATCTGTCTGCAGCCCAGTTGAACTTCGC AGTGCTGCTGGAAGAATGGAAGTTGTTAATTCAAGTTCAACAAGTGTGAATTTCACTCCG GGAAGGCCGCTGAAGTCATTCATTCCACGTGGAGCAAGTTCAATTCTTCAATTCACACTA AAAATATTAGCATGTATATTTCTTGTATTCCCAAGGTTGTGGAGAATATTTGCCGCACAT CGTGAAGAGAACCACTTAAAAAGTTCATGCGAACCACTGCGGCTTGCAAATTCAAGTTCT CAGGGACAGCACATTTCACAGGGAATAGAAGTAGACCCGCTCTGGCAGAGGCTGCAGCAA TTAGAAGGGTTGGTTACTGAGTTGATTAACAAACCTACAAAAATTCCTGCAGAGAAAGAA GACATGCTTCATGAATCTTTGAGTCGTATTAAATCTATAGAATATGACTTACAGAAGACA AAGAAAGCATTGCTTGCAACTGCATCAAAACAAGTGGAGCTTGCTGAGTCACTGGAAAGT TTAAAGGAAGACAGCTCGACTGGATCAAATTCTTGTTGGCCAAGAAGTTGCAGTTATAAT CACAACCCGGGAAGATGA
PEP MPGEVVAFQEDEKSRTFDFETSEDERRWSRGRSLKKKTTNASLRLTNSLRKRRKRVANCR YALISIEDVRDAEEEEAVITFREALVARDMLPAQYDDYHTMLRFLKARKFDIHKAVHMWA EMLNWRKEFGVESIVKDFVYSEYEEVQRFYPHGYHGVDKEGRPVYIERVGKVEPSKLMNV TTVDRFLKYHVQGFEKAFAEKFPACSIAAKRHIDSTTTILDVQGLNWVSFGKVAHDLVMR MQKIDGDNYPEVLGNKFRSKLLEVIDSSQLPDFLGGTCSCPNEGGCLRSGKGPWNDPEIV KLVHIGETMDLRKINGSSDGDDLGVKLIASKVTENEIISAPESGSEMMSSVSGFLQLLTS HSDKRRASDSASVCSPVELRSAAGRMEVVNSSSTSVNFTPGRPLKSFIPRGASSILQFTL KILACIFLVFPRLWRIFAAHREENHLKSSCEPLRLANSSSQGQHISQGIEVDPLWQRLQQ LEGLVTELINKPTKIPAEKEDMLHESLSRIKSIEYDLQKTKKALLATASKQVELAESLES LKEDSSTGSNSCWPRSCSYNHNPGR


| Top |